Sequence 1: | NP_650473.1 | Gene: | CG5213 / 41892 | FlyBaseID: | FBgn0038345 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001104764.1 | Gene: | Hnrnpa3 / 362152 | RGDID: | 727807 | Length: | 379 | Species: | Rattus norvegicus |
Alignment Length: | 203 | Identity: | 55/203 - (27%) |
---|---|---|---|
Similarity: | 89/203 - (43%) | Gaps: | 27/203 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 DPPPPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDY--VS 91
Fly 92 ERQAA--AAVNGMDGYETRGKRLKVAFARPSEYES----TSSSLYVGNLPTYMDEKKVRELFATY 150
Fly 151 GNIVDVNLLRHKFNNRSRGVAFLQF---ELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKKGS 212
Fly 213 SSTSSGSQ 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5213 | NP_650473.1 | RRM1_Hu_like | 41..117 | CDD:240821 | 24/79 (30%) |
RRM | 128..202 | CDD:214636 | 19/76 (25%) | ||
Hnrnpa3 | NP_001104764.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..35 | 3/8 (38%) | |
RRM1_hnRNPA_like | 36..113 | CDD:409992 | 24/79 (30%) | ||
RRM2_hnRNPA3 | 126..205 | CDD:409996 | 19/82 (23%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 204..225 | 5/15 (33%) | |||
HnRNPA1 | 332..>348 | CDD:402981 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 335..379 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1202220at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |