DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and Rsf1

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001260318.1 Gene:Rsf1 / 34370 FlyBaseID:FBgn0011305 Length:200 Species:Drosophila melanogaster


Alignment Length:172 Identity:44/172 - (25%)
Similarity:58/172 - (33%) Gaps:54/172 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 ESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVA--- 184
            :...:.:|||||...:.:..:...|..||.:   |.:...||  ..|.||::||...|||.|   
  Fly     6 DQRGTRVYVGNLTDKVKKDDLEGEFTKYGKL---NSVWIAFN--PPGFAFVEFEHRDDAEKACDI 65

  Fly   185 --------------------KYG-----MDRYMIEGASR------PLTV------KFVEREKKGS 212
                                :.|     |||    |..|      .:|.      .|.:|...||
  Fly    66 LNGSELLGSQLRVEISKGRPRQGRRGGPMDR----GGRRGDFGRHSITSGGSGGGGFRQRGSSGS 126

  Fly   213 SSTSSGSQYKDKRKSSPPPYKRRE----RTNDHHVSKRSRDS 250
            ||..:...|...| |....|..||    ..|...|....|||
  Fly   127 SSRHTERGYSSGR-SGASSYNGREGGGSGFNRREVYGGGRDS 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821
RRM 128..202 CDD:214636 26/107 (24%)
Rsf1NP_001260318.1 RRM_SRSF3_like 11..82 CDD:409808 20/75 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23147
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.