DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and x16

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster


Alignment Length:247 Identity:59/247 - (23%)
Similarity:88/247 - (35%) Gaps:80/247 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDGYETRGKRL 112
            |..:..:::|..:|..:|.:|...|.|:...     :.||::.|.|.||.||.|:||....|:|.
  Fly    15 LGNNARKNDLEYVFGAYGSLRSVWIARNPPG-----FAFVEFESARDAADAVRGLDGRTVCGRRA 74

  Fly   113 KV-----AFARPSE-----------------------------YESTSSSLYVGNLPTYMDEKKV 143
            :|     .:||...                             ||....    |:...:..|:|.
  Fly    75 RVELSTGK
YARSGGGGGGGGGGGGGGGLGGRDRGGGGRGDDKCYECGGR----GHFARHCRERKA 135

  Fly   144 RELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVER- 207
            |:              |.:.|:.||..:..:....|    :|.|.       .||..:...|.| 
  Fly   136 RQ--------------RRRSNSFSRSRSTSRRRRTR----SKSGT-------RSRSRSAGSVGRR 175

  Fly   208 --EKKGSSSTSSGSQYKDKRKS------SPPPYKRR-ERTNDHHV--SKRSR 248
              ...|.....|.|:|.|..::      ||||.||| |..:|..|  |.|||
  Fly   176 SGRSNGRDENGSASRYSDHERNGSGAVDSPPPPKRRYEDEDDDRVRGSPRSR 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 21/73 (29%)
RRM 128..202 CDD:214636 13/73 (18%)
x16NP_723226.1 RRM <1..>82 CDD:223796 21/71 (30%)
RRM_SRSF3_like 9..81 CDD:240819 21/70 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.