DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and crp79

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001018242.1 Gene:crp79 / 3361521 PomBaseID:SPAC1610.03c Length:710 Species:Schizosaccharomyces pombe


Alignment Length:160 Identity:44/160 - (27%)
Similarity:62/160 - (38%) Gaps:33/160 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TKKESSVPTLCWGYAGIRGMF-QTGRPV------------------DPPPPLPNLRM-KTNLILN 46
            ||::|.     ||.....|:. |...|.                  :..|.:||..: .:||.:.
pombe   328 TKEKSQ-----WGSVSTTGVSNQQNHPAAWNPDNKPQSIVHWDSLRESSPSIPNSPIDPSNLYVK 387

  Fly    47 YLPQDM--TESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMD---GYE 106
            .|...:  .:|:|..|||.||.|..:.:..:..:|||..||||.:   ||..|||...|   |..
pombe   388 NLDDTVITCKSQLEDLFSPFGSILSSMLACYPNSGISKGYGFVAF---RQIEAAVRAKDTLNGMM 449

  Fly   107 TRGKRLKVAFARPSEYESTSSSLYVGNLPT 136
            ...||:.|.||............:..|.||
pombe   450 VGKKRIFVCFAERKSDRIRRLQAFFANKPT 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 28/80 (35%)
RRM 128..202 CDD:214636 3/9 (33%)
crp79NP_001018242.1 RRM_RBM18 18..106 CDD:240801
RRM 109..>289 CDD:223796
RRM_SF 205..276 CDD:240668
RRM2_I_PABPs 380..459 CDD:240825 28/81 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.