DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and hnrnpa0a

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_997810.2 Gene:hnrnpa0a / 323529 ZFINID:ZDB-GENE-030131-2249 Length:305 Species:Danio rerio


Alignment Length:187 Identity:43/187 - (22%)
Similarity:84/187 - (44%) Gaps:18/187 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNG----MD 103
            |.:..|....|:..|...|.::|::....::::::...|.|:|||.|.|..:|.:|::.    :|
Zfish    12 LFVGGLNVQTTDDGLRNHFEQYGKLTDCVVVQNQQLKRSRCFGFVTYSSPDEADSAMSARPHILD 76

  Fly   104 GYETRGKRLKVAFARPS----EYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFN 164
            |   ....||.|.||..    |..:....:::|.|...::|..:|:.|:.:|.:....::..|..
Zfish    77 G---NNVELKRAV
AREDAGKPEALAKVKKIFIGGLKDDIEEDHLRDCFSQFGAVEKAEVITDKET 138

  Fly   165 NRSRGVAFLQFE---LVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKKGSSSTSSG 218
            .:.||..|:.||   ....|.|.|:    ::|.|....:.....::|.:.:.|...|
Zfish   139 GKKRGFGFVYFEDNDSADKAVVLKF----HIINGHKVEVKKALTKQEMQAAGSRGGG 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 20/77 (26%)
RRM 128..202 CDD:214636 17/76 (22%)
hnrnpa0aNP_997810.2 RRM1_hnRNPA0 8..86 CDD:240772 19/76 (25%)
RRM_SF 102..181 CDD:302621 17/82 (21%)
HnRNPA1 260..286 CDD:288479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.