DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and HNRNPAB

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_112556.2 Gene:HNRNPAB / 3182 HGNCID:5034 Length:332 Species:Homo sapiens


Alignment Length:190 Identity:48/190 - (25%)
Similarity:87/190 - (45%) Gaps:21/190 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDGYETR--GK 110
            |..|.::.:|...|:||||:....|.....||.|..:||:.:   :.||:....:|..|.|  |:
Human    77 LSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILF---KDAASVEKVLDQKEHRLDGR 138

  Fly   111 RL--KVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFL 173
            .:  |.|.|...:   ....::||.|.....|:|:||.|..:|.|..:.|......|:.||..|:
Human   139 VIDPKKA
MAMKKD---PVKKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFI 200

  Fly   174 QFELVRDAEVAKYGMDR--YMIEGASRPLTV----KFVEREKKGSSSTSSGSQYKDKRKS 227
            .|   ::.|..|..:::  :.:.|:...:.|    :..::::.||.  ..|::.:..|.|
Human   201 TF---KEEEPVKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSG--GRGNRNRGNRGS 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 22/72 (31%)
RRM 128..202 CDD:214636 19/75 (25%)
HNRNPABNP_112556.2 CBFNT 1..70 CDD:311868
RRM1_hnRNPAB 66..145 CDD:410151 21/70 (30%)
RRM2_hnRNPAB 150..229 CDD:409997 19/84 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.