Sequence 1: | NP_650473.1 | Gene: | CG5213 / 41892 | FlyBaseID: | FBgn0038345 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_112420.1 | Gene: | HNRNPA1 / 3178 | HGNCID: | 5031 | Length: | 372 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 49/207 - (23%) |
---|---|---|---|
Similarity: | 90/207 - (43%) | Gaps: | 21/207 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 MFQTGRPVDPPPPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYG 85
Fly 86 FVDYVSERQAAAAVNG----MDGYETRGKRL--KVAFARPSEYESTSSSLYVGNLPTYMDEKKVR 144
Fly 145 ELFATYGNIVDVNLLRHKFNNRSRGVAFLQF---ELVRDAEVAKYGMDRYMIEGASRPLTVKFVE 206
Fly 207 REKKGSSSTSSG 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5213 | NP_650473.1 | RRM1_Hu_like | 41..117 | CDD:240821 | 20/81 (25%) |
RRM | 128..202 | CDD:214636 | 17/76 (22%) | ||
HNRNPA1 | NP_112420.1 | Globular A domain | 4..94 | 24/96 (25%) | |
RRM1_hnRNPA1 | 12..92 | CDD:410154 | 22/82 (27%) | ||
Globular B domain | 95..185 | 20/94 (21%) | |||
RRM2_hnRNPA3 | 105..184 | CDD:409996 | 17/82 (21%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 182..216 | 4/14 (29%) | |||
RNA-binding RGG-box | 218..240 | ||||
HnRNPA1 | 307..344 | CDD:402981 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 317..372 | ||||
Nuclear targeting sequence (M9) | 320..357 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1202220at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |