DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and HNRNPA1

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_112420.1 Gene:HNRNPA1 / 3178 HGNCID:5031 Length:372 Species:Homo sapiens


Alignment Length:207 Identity:49/207 - (23%)
Similarity:90/207 - (43%) Gaps:21/207 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 MFQTGRPVDPPPPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYG 85
            |.::..|.:|    ..||   .|.:..|..:.|:..|...|.::|.:....::|...|..|..:|
Human     1 MSKSESPKEP----EQLR---KLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFG 58

  Fly    86 FVDYVSERQAAAAVNG----MDGYETRGKRL--KVAFARPSEYESTSSSLYVGNLPTYMDEKKVR 144
            ||.|.:..:..||:|.    :||.....||.  :....||..: .|...::||.:....:|..:|
Human    59 FVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAH-LTVKKIFVGGIKEDTEEHHLR 122

  Fly   145 ELFATYGNIVDVNLLRHKFNNRSRGVAFLQF---ELVRDAEVAKYGMDRYMIEGASRPLTVKFVE 206
            :.|..||.|..:.::..:.:.:.||.||:.|   :.|....:.||    :.:.|.:..:.....:
Human   123 DYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKY----HTVNGHNCEVRKALSK 183

  Fly   207 REKKGSSSTSSG 218
            :|...:||:..|
Human   184 QEMASASSSQRG 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 20/81 (25%)
RRM 128..202 CDD:214636 17/76 (22%)
HNRNPA1NP_112420.1 Globular A domain 4..94 24/96 (25%)
RRM1_hnRNPA1 12..92 CDD:410154 22/82 (27%)
Globular B domain 95..185 20/94 (21%)
RRM2_hnRNPA3 105..184 CDD:409996 17/82 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 182..216 4/14 (29%)
RNA-binding RGG-box 218..240
HnRNPA1 307..344 CDD:402981
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..372
Nuclear targeting sequence (M9) 320..357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.