DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and ssx

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster


Alignment Length:215 Identity:79/215 - (36%)
Similarity:116/215 - (53%) Gaps:13/215 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDGY 105
            ||||:||||||||:.||:.|||..|.|...||:|..:||.|..||||||.:|..:..|:..::|:
  Fly    93 TNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRDFKTGYSFGYGFVDYKTESDSEDAIQKLNGF 157

  Fly   106 ETRGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGV 170
            ..|.|||||::|||.......::|||.||...:::..:..:|:.||.||..|:||.|...|.|||
  Fly   158 YVRNKRLKVSYARPGGQSIKDTNLYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGV 222

  Fly   171 AFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKK------------GSSSTSSGSQYKD 223
            ||:::....:|:.|...::..:.||.|:|:.|:..|...|            |:.....|..:..
  Fly   223 AFVRYNKREEAQEAIKALNNTVPEGGSQPIWVRLAEEHGKAKAAQFMAQIGGGNGGGGGGPPHMG 287

  Fly   224 K-RKSSPPPYKRRERTNDHH 242
            . ....||.:......|:||
  Fly   288 PGGPMHPPHHHNNHHHNNHH 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 40/75 (53%)
RRM 128..202 CDD:214636 26/73 (36%)
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 43/79 (54%)
RRM_SF 179..257 CDD:302621 27/77 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439579
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BKYN
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 1 1.000 - - mtm1072
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.