DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and elav

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001245447.1 Gene:elav / 31000 FlyBaseID:FBgn0260400 Length:483 Species:Drosophila melanogaster


Alignment Length:214 Identity:73/214 - (34%)
Similarity:111/214 - (51%) Gaps:27/214 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHR-------------RTGISCCYGFVDYVS 91
            :||||:|||||.|||.|:..|||..|||...|:||.:             ..|.|..||||:||.
  Fly   148 RTNLIVNYLPQTMTEDEIRSLFSSVGEIESVKLIRDKSQVYIDPLNPQAPSKGQSLGYGFVNYVR 212

  Fly    92 ERQAAAAVNGMDGYETRGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDV 156
            .:.|..|||.::|...:.|.:||:|||||......::|||..||..|.::::..:||.:|.|:..
  Fly   213 PQDAEQAVNVLNGLRLQNKTIKVSFARPSSDAIKGANLYVSGLPKTMTQQELEAIFAPFGAIITS 277

  Fly   157 NLLRHKFNN-RSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKKGSSSTSSGSQ 220
            .:|::..|: :::||.|::|:...:|..|...::.......:.|:.|||         |.:.||.
  Fly   278 RILQNAGNDTQTKGVGFIRFDKREEATRAIIALNGTTPSSCTDPIVVKF---------SNTPGST 333

  Fly   221 YKDKRKSSP----PPYKRR 235
            .|..:...|    |...||
  Fly   334 SKIIQPQLPAFLNPQLVRR 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 38/88 (43%)
RRM 128..202 CDD:214636 19/74 (26%)
elavNP_001245447.1 ELAV_HUD_SF 146..483 CDD:273741 73/214 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I1646
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000313
OrthoInspector 1 1.000 - - mtm1072
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.