DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and Srsf12

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001129183.1 Gene:Srsf12 / 297962 RGDID:1561162 Length:261 Species:Rattus norvegicus


Alignment Length:140 Identity:44/140 - (31%)
Similarity:72/140 - (51%) Gaps:12/140 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 FARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRD 180
            :.||     .::||:|.|:......:.:|..|..||.||||.:....::.|.||.|::|||.|||
  Rat     4 YTRP-----PNTSLFVRNVADATRPEDLRREFGRYGPIVDVYIPLDFYSRRPRGFAYVQFEDVRD 63

  Fly   181 AEVAKYGMDRYMIEGASRPLTVKFVEREKKGSSSTSSGSQY----KDKRKSSPPPYKR-RERTND 240
            ||.|.|.::|..:.|  |.:.::|.:.::|......|..::    .|.|:|..|..:| |.|::.
  Rat    64 AEDALYNLNRKWVCG--RQIEIQFAQGDRKTPGQMKSKERHLCSPSDHRRSRSPSQRRSRSRSSS 126

  Fly   241 HHVSKRSRDS 250
            ....:|..||
  Rat   127 WGRDRRRSDS 136

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity