DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and bru2

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001036356.1 Gene:bru2 / 250811 FlyBaseID:FBgn0262475 Length:893 Species:Drosophila melanogaster


Alignment Length:199 Identity:55/199 - (27%)
Similarity:97/199 - (48%) Gaps:22/199 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGIS--CCYGFVDYVSERQ 94
            |...|::|    .:..:|:...|:.|.::|.:||.:....::|.:.|.||  ||  ||.|.:.:.
  Fly   290 PDADNIKM----FVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCC--FVTYYTRKA 348

  Fly    95 AAAAVNGMDGYETRGKRLKVAFARPSEYESTSS-SLYVGNLPTYMDEKKVRELFATYGNIVDVNL 158
            |..|.:.:...:|..........:|::.|:.:. .|:||.|.....|..||:||..:|.|.:..:
  Fly   349 ALRAQDALHNIKTLDGMHHPIQMKPADSENRNERKLFVGMLNKKYTEADVRQLFTGHGTIEECTV 413

  Fly   159 LRHKFNNRSRGVAFLQFELVRDAEVAKYGMDR-YMIEGASRPLTVKFVEREKKGSSSTSSGSQYK 222
            ||.: ..:|:|.||:.|...::|..|...:.: ..:||.|.||.|||.:.:|:           |
  Fly   414 LRDQ-AGQSKGCAFVTFATKQNAIGAIKALHQSQTMEGCSAPLVVKFADTQKE-----------K 466

  Fly   223 DKRK 226
            |::|
  Fly   467 DQKK 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 18/77 (23%)
RRM 128..202 CDD:214636 25/74 (34%)
bru2NP_001036356.1 RRM1_CELF1_2_Bruno 294..375 CDD:241075 21/86 (24%)
RRM2_Bruno_like 381..461 CDD:241080 28/80 (35%)
RRM_SF 801..892 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I1646
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.