DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and HNRNPA3

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001317178.1 Gene:HNRNPA3 / 220988 HGNCID:24941 Length:378 Species:Homo sapiens


Alignment Length:203 Identity:55/203 - (27%)
Similarity:89/203 - (43%) Gaps:27/203 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DPPPPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDY--VS 91
            ||..| ..||   .|.:..|..:.|:..|...|.|:|.:....::|..:|..|..:|||.|  |.
Human    27 DPKEP-EQLR---KLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVE 87

  Fly    92 ERQAA--AAVNGMDGYETRGKRLKVAFARPSEYES----TSSSLYVGNLPTYMDEKKVRELFATY 150
            |..||  |..:.:||.....||   |.:|....:.    |...::||.:....:|..:|:.|..|
Human    88 EVDAAMCARPHKVDGRVVEPKR---AVSREDSVKPGAHLTVKKIFVGGIKEDTEEYNLRDYFEKY 149

  Fly   151 GNIVDVNLLRHKFNNRSRGVAFLQF---ELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKKGS 212
            |.|..:.::..:.:.:.||.||:.|   :.|....|.||    :.|.|.:..:.....::|.:  
Human   150 GKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKY----HTINGHNCEVKKALSKQEMQ-- 208

  Fly   213 SSTSSGSQ 220
               |:|||
Human   209 ---SAGSQ 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 24/79 (30%)
RRM 128..202 CDD:214636 19/76 (25%)
HNRNPA3NP_001317178.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 3/8 (38%)
RRM1_hnRNPA_like 36..113 CDD:409992 24/79 (30%)
RRM2_hnRNPA3 126..205 CDD:409996 19/82 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..225 5/15 (33%)
HnRNPA1 331..>347 CDD:402981
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 336..378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.