DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and hrpa-1

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001040945.1 Gene:hrpa-1 / 177101 WormBaseID:WBGene00001999 Length:347 Species:Caenorhabditis elegans


Alignment Length:215 Identity:49/215 - (22%)
Similarity:81/215 - (37%) Gaps:60/215 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVN 100
            |||   .:.:..|..:.|:..:...:|:||||....::|...|..|..:|||.:..:.:..||:.
 Worm    21 NLR---KIFVGGLTSNTTDDLMREFYSQFGEITDIIVMRDPTTKRSRGFGFVTFSGKTEVDAAMK 82

  Fly   101 G----MDGYETRGKRLKVAFARPSEYESTSSS------LYVGNLPTYMDEKKVRELFATYGNIVD 155
            .    :||.....||     |.|.:.::.|.|      |||..:.....|..:.|.|..||.:..
 Worm    83 QRPHIIDGKTVDPKR-----AVPRDDKNRSESNVSTKRLYVSGVREDHTEDMLTEYFTKYGTVTK 142

  Fly   156 VNLLRHKFNNRSRGVAFLQFE--------------------------LVRDAEVAKYGMDRYMIE 194
            ..::..|...:.||..|:.|:                          |.:| |::|..|:|    
 Worm   143 SEIILDKATQKPRGFGFVTFDDHDSVDQCVLQKSHMVNGHRCDVRKGLSKD-EMSKAQMNR---- 202

  Fly   195 GASRPLTVKFVEREKKGSSS 214
                       :||.:|..|
 Worm   203 -----------DRETRGGRS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 19/79 (24%)
RRM 128..202 CDD:214636 20/105 (19%)
hrpa-1NP_001040945.1 RRM1_hnRNPA_like 24..101 CDD:241022 20/81 (25%)
RRM2_hnRNPA_like 115..187 CDD:240774 13/71 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.