DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and rsp-3

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001370111.1 Gene:rsp-3 / 176688 WormBaseID:WBGene00004700 Length:258 Species:Caenorhabditis elegans


Alignment Length:248 Identity:56/248 - (22%)
Similarity:94/248 - (37%) Gaps:61/248 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDGYETRGKRL 112
            ||.|:.|.|:..:|.|:|.|:...|    ::|....:.||::...|.|..||...||||..|:|:
 Worm    16 LPGDVREKEVEDIFHKYGRIKYVDI----KSGRGPAFAFVEFEDHRDAEDAVRARDGYEFDGRRI 76

  Fly   113 KVAF----------ARPSE----------------------YESTSSSLYVGNLPTYMDEKKVRE 145
            :|.|          .||.:                      ...|...:.|..||.....:.:::
 Worm    77 RVEF
TRGVGPRGPGGRPLQDGGDHRGGDFRGGRGGGRGGGPQRRTGYRVIVEGLPPTGSWQDLKD 141

  Fly   146 LFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMI---EGASRPLTVKFVER 207
            .....|::...::.|.       |...::|....|.:.|...:|....   ||.:..:.|:    
 Worm   142 HMRDAGDVCYADVARD-------GTGVVEFTRYEDVKYAVRKLDDTKFRSHEGETAYIRVR---- 195

  Fly   208 EKKGSSSTSSGSQYKDK---------RKSSPPPYKRRERTNDHHVSK-RSRDS 250
             :..||...||...:|:         |::||....||.|:.....|: |||.:
 Worm   196 -EDNSSGGGSGGGGRDRSRSRSPRAERRASPKYSPRRSRSRSRSRSRSRSRSA 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 25/78 (32%)
RRM 128..202 CDD:214636 12/76 (16%)
rsp-3NP_001370111.1 RRM1_SRSF1_like 10..80 CDD:409775 24/67 (36%)
RRM2_SRSF1_like 123..196 CDD:410013 13/84 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23147
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.