Sequence 1: | NP_650473.1 | Gene: | CG5213 / 41892 | FlyBaseID: | FBgn0038345 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001370111.1 | Gene: | rsp-3 / 176688 | WormBaseID: | WBGene00004700 | Length: | 258 | Species: | Caenorhabditis elegans |
Alignment Length: | 248 | Identity: | 56/248 - (22%) |
---|---|---|---|
Similarity: | 94/248 - (37%) | Gaps: | 61/248 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 LPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDGYETRGKRL 112
Fly 113 KVAF----------ARPSE----------------------YESTSSSLYVGNLPTYMDEKKVRE 145
Fly 146 LFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMI---EGASRPLTVKFVER 207
Fly 208 EKKGSSSTSSGSQYKDK---------RKSSPPPYKRRERTNDHHVSK-RSRDS 250 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5213 | NP_650473.1 | RRM1_Hu_like | 41..117 | CDD:240821 | 25/78 (32%) |
RRM | 128..202 | CDD:214636 | 12/76 (16%) | ||
rsp-3 | NP_001370111.1 | RRM1_SRSF1_like | 10..80 | CDD:409775 | 24/67 (36%) |
RRM2_SRSF1_like | 123..196 | CDD:410013 | 13/84 (15%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23147 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |