DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and Hnrnpab

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001041526.1 Gene:Hnrnpab / 15384 MGIID:1330294 Length:332 Species:Mus musculus


Alignment Length:191 Identity:47/191 - (24%)
Similarity:89/191 - (46%) Gaps:23/191 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDGYETR--GK 110
            |..|.::.:|...|:||||:....|.....||.|..:||:.:   :.:::....:|..|.|  |:
Mouse    82 LSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILF---KDSSSVEKVLDQKEHRLDGR 143

  Fly   111 RL--KVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNL-LRHKFNNRSRGVAF 172
            .:  |.|.|...:   ....::||.|.....|:|:||.|..:|.|..:.| :..|.|.| ||..|
Mouse   144 VIDPKKA
MAMKKD---PVKKIFVGGLNPEATEEKIREYFGQFGEIEAIELPIDPKLNKR-RGFVF 204

  Fly   173 LQFELVRDAEVAKYGMDR--YMIEGASRPLTV----KFVEREKKGSSSTSSGSQYKDKRKS 227
            :.|   ::.:..|..:::  :.:.|:...:.|    :..::::.||.  ..|::.:..|.|
Mouse   205 ITF---KEEDPVKKVLEKKFHTVSGSKCEIKVAQPKEVYQQQQYGSG--GRGNRNRGNRGS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 20/72 (28%)
RRM 128..202 CDD:214636 20/76 (26%)
HnrnpabNP_001041526.1 CBFNT 1..75 CDD:285369
RRM1_hnRNPAB 76..150 CDD:241201 19/70 (27%)
RRM2_hnRNPAB 155..234 CDD:241028 20/85 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.