DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and Srsf10

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001073856.1 Gene:Srsf10 / 14105 MGIID:1333805 Length:262 Species:Mus musculus


Alignment Length:147 Identity:47/147 - (31%)
Similarity:71/147 - (48%) Gaps:26/147 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 FARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRD 180
            :.||     .::||:|.|:......:.:|..|..||.||||.:....:..|.||.|::|||.|||
Mouse     4 YLRP-----PNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRD 63

  Fly   181 AEVAKYGMDRYMIEGASRPLTVKFVEREKKGSS--------STSSGSQYKD---KRKSSPPPYKR 234
            ||.|.:.:||..|.|  |.:.::|.:.::|..:        :..|.|:|.|   .|:|....|:|
Mouse    64 AEDALHNLDRKWICG--RQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYER 126

  Fly   235 RERTNDHHVSKRSRDSD 251
            |.        .|||..|
Mouse   127 RR--------SRSRSFD 135

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity