DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and AgaP_AGAP008433

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_317010.3 Gene:AgaP_AGAP008433 / 1277542 VectorBaseID:AGAP008433 Length:526 Species:Anopheles gambiae


Alignment Length:223 Identity:52/223 - (23%)
Similarity:89/223 - (39%) Gaps:44/223 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GIRGMFQTGRPVDPPP----------------PLPNL----RMKTNLILNYLPQDMTESELHRLF 61
            |.|||.:..|.:.|.|                ||..:    |....:....|.|.:...:|...|
Mosquito   127 GGRGMGRGRRSMSPKPYRGRGRGGSGYYRDRSPLEEMSQEDRDARTVFCMQLSQRIHARDLEEFF 191

  Fly    62 SKFGEIRKAKIIRHRRT----GISCCYGFVDYVSERQAAAAVNGMDGYETRGKRLKVAFAR---- 118
            |..|::|..::|...:|    ||:    ::::......|.|: |:.|.:..|..:.|...:    
Mosquito   192 SSVGKVRDVRLITCNKTKRFKGIA----YIEFKDPESVALAL-GLSGQKLLGIPISVQHTQAEKN 251

  Fly   119 ---------PSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQ 174
                     |.:..|....||||:|...:.|..:..:|..:|.|.::.|:......||:|..|:.
Mosquito   252 RMASQPPVAPPKNPSGPMRLYVGSLHFNITEDMLNGIFEPFGKIDNIQLIMDADTGRSKGYGFIT 316

  Fly   175 FELVRDAEVAKYGMDRYMIEGASRPLTV 202
            |....||:.|...::.:  |.|.||:.|
Mosquito   317 FHNADDAKKALEQLNGF--ELAGRPMKV 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 17/79 (22%)
RRM 128..202 CDD:214636 22/73 (30%)
AgaP_AGAP008433XP_317010.3 PRP38_assoc <40..109 CDD:289628
SF-CC1 53..511 CDD:273721 52/223 (23%)
RRM1_RBM39_like 172..244 CDD:240729 16/76 (21%)
RRM2_RBM23_RBM39 271..343 CDD:240730 23/74 (31%)
RBM39linker 360..436 CDD:292157
RRM3_RBM39_like 418..502 CDD:240731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.