DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and HNRNPA0

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_006796.1 Gene:HNRNPA0 / 10949 HGNCID:5030 Length:305 Species:Homo sapiens


Alignment Length:187 Identity:50/187 - (26%)
Similarity:82/187 - (43%) Gaps:15/187 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQA----AAAVNGMD 103
            |.:..|....:||.|...|..||.:....::.:.:|..|.|:|||.|.:..:|    ||:.:.:|
Human     9 LFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPHAVD 73

  Fly   104 GYETRGKRL--KVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNR 166
            |.....||.  :...|||..:... ..|:||.|...:.|..:.|.|:.:|.:....::..|.:.:
Human    74 GNTVELKRAV
SREDSARPGAHAKV-KKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGK 137

  Fly   167 SRGVAFLQF---ELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKKGSSSTSSGSQ 220
            .||..|:.|   :....|.|.|:    :.|:| .|....|.|.:|...|.....||:
Human   138 KRGFGFVYFQNHDAADKAAVVKF----HPIQG-HRVEVKKAVPKEDIYSGGGGGGSR 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 22/79 (28%)
RRM 128..202 CDD:214636 19/76 (25%)
HNRNPA0NP_006796.1 RRM1_hnRNPA0 5..83 CDD:240772 22/73 (30%)
RRM2_hnRNPA0 99..178 CDD:241023 21/83 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..214 5/16 (31%)
HnRNPA1 255..>269 CDD:314495
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..305
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.