DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and Tra2a

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_006505303.1 Gene:Tra2a / 101214 MGIID:1933972 Length:309 Species:Mus musculus


Alignment Length:165 Identity:39/165 - (23%)
Similarity:63/165 - (38%) Gaps:47/165 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVA------ 184
            ::.|.|..|..|..|:.:||:|:.||.:..||::..:...||||.||:.||.:.|::.|      
Mouse   143 NTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANG 207

  Fly   185 ------KYGMDRYMIEGASRPLTVKFVEREKKGSSSTSSG------------------------- 218
                  :..:|..:.:.|..|....::.|..........|                         
Mouse   208 MELDGRRIRVDYSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGGGRRRDSYYDRGYDRG 272

  Fly   219 -SQYKD----KRKSSPPPYKRRERTNDHHVSKRSR 248
             .:|:|    .|:.||.||..|.|:.     .|||
Mouse   273 YDRYEDYDYRYRRRSPSPYYSRYRSR-----SRSR 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821
RRM 128..202 CDD:214636 25/85 (29%)
Tra2aXP_006505303.1 RRM_TRA2 143..222 CDD:409798 23/78 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_117020
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.