DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and rbm15b

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_002935665.2 Gene:rbm15b / 100495588 XenbaseID:XB-GENE-961063 Length:786 Species:Xenopus tropicalis


Alignment Length:251 Identity:58/251 - (23%)
Similarity:96/251 - (38%) Gaps:35/251 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GMFQTGRPVDPP-PPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCC 83
            ||..|....|.. .|..:.|...||.:..|...::|.:|.|.|.|:|.|.:..|.|..| |....
 Frog   252 GMSSTSTADDEQLAPEDDHRATRNLFIGNLDHMVSEVDLRRAFDKYGPIEEVVIKRPGR-GQGAA 315

  Fly    84 YGFVDYVSERQAAAAVNGMDGYETRGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFA 148
            |.|:.:.:...|..|...|.|.......:|:.:.:|    :.|:.|:||.|........:...|.
 Frog   316 YAFLRFQNLDMAHRAKLAMSGRLLGRNAMKIGYGKP----NPSTRLWVGGLGPNTSLAALAREFD 376

  Fly   149 TYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKKGSS 213
            .:|:|..|:.:      :....|::|:|.:..|:.|...|..:.:  ..|.|.|.|.......::
 Frog   377 RFGSIRTVDYV------KGDSFAYIQYESLDAAQAACTQMRGFAL--GDRRLRVDFATVSPDEAA 433

  Fly   214 STSS--------------------GSQYKDKRKSSPPPYKRRERTNDHHV-SKRSR 248
            :.:|                    ...|...|.:..|..:.|:||..|.: |.|.|
 Frog   434 AAASRYAPLQTTPYPLPLPYELLQPEAYSRHRTALDPDLRVRDRTPPHLLYSDRER 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 21/75 (28%)
RRM 128..202 CDD:214636 16/73 (22%)
rbm15bXP_002935665.2 RRM1_RBM15B 113..192 CDD:240998
RRM2_RBM15B 266..350 CDD:241000 23/84 (27%)
RRM_SF 353..426 CDD:388407 19/80 (24%)
SPOC 616..783 CDD:369497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.