DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and hnrnpa3

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_031748359.1 Gene:hnrnpa3 / 100144993 XenbaseID:XB-GENE-5878765 Length:385 Species:Xenopus tropicalis


Alignment Length:202 Identity:50/202 - (24%)
Similarity:92/202 - (45%) Gaps:19/202 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DPPPPLPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSER 93
            :|..| ..||   .|.:..|..:.|:..|...|.::|::....::|..:|..|..:|||.|....
 Frog    85 EPKEP-EQLR---KLFIGGLSFETTDDSLREHFEQWGKLTDCVVMRDPQTKRSRGFGFVTYSCVE 145

  Fly    94 QAAAAVNG----MDGYETRGKRL--KVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGN 152
            :..||::.    :||.....||.  :...|||..: .|...::||.:....:|..:|:.|.:||.
 Frog   146 EVDAAMSARPHKVDGRVVEPKRAVSREDSARPGAH-LTVKKIFVGGIKEDTEEYHLRDYFQSYGK 209

  Fly   153 IVDVNLLRHKFNNRSRGVAFLQF---ELVRDAEVAKYGMDRYMIEGASRPLTVKFVEREKKGSSS 214
            |..:.::..:.:.:.||.||:.|   :.|....|.||    :.|.|.:..:. |.:.:::..::|
 Frog   210 IETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKY----HTINGHNCEVK-KALSKQEMQTAS 269

  Fly   215 TSSGSQY 221
            ...|..|
 Frog   270 AQRGGNY 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 19/81 (23%)
RRM 128..202 CDD:214636 19/76 (25%)
hnrnpa3XP_031748359.1 RRM1_hnRNPA_like 94..171 CDD:409992 19/76 (25%)
RRM2_hnRNPA3 184..263 CDD:409996 20/83 (24%)
HnRNPA1 328..>344 CDD:402981
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.