DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5213 and zcrb1

DIOPT Version :9

Sequence 1:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001107973.1 Gene:zcrb1 / 100135752 XenbaseID:XB-GENE-999756 Length:215 Species:Xenopus tropicalis


Alignment Length:225 Identity:48/225 - (21%)
Similarity:90/225 - (40%) Gaps:64/225 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 KTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAVNGMDG 104
            |:.:.::.||..:|.::|||:|||:|::.|..|::.:.:..|....||.::.:..:...|.|::.
 Frog     9 KSTVYVSNLPFSLTNNDLHRIFSKYGKVVKVTILKDKDSRRSKGVAFVLFLDKESSQNCVRGLNN 73

  Fly   105 YETRGKRLKVAFA----RPSEY-----ESTSSSLY----VGNL-------------PTYMDEKKV 143
            .:..|:.:|.:.|    |.:|:     .:..|..|    .|:|             |....|||.
 Frog    74 KQLFGRAIKASIAIDNGRATEFIRRRNYTDKSRCYECGDTGHLSYACPKNMLGEREPPQKKEKKK 138

  Fly   144 RELFATYGNIVDVNLLRH----------KFNNRSRGVAFLQFELVRDAEVAKYGMDRYMIEGASR 198
            |:      .||:..:...          ..::.|:.:||.|..:  :.|..||            
 Frog   139 RK------KIVEAEVFEEDESEDEGEDPALDSLSQAIAFQQARI--EEEKNKY------------ 183

  Fly   199 PLTVKFVEREKKGSSSTSSGSQYKDKRKSS 228
                    |.....:|||..|:....:||:
 Frog   184 --------RHDAAEASTSEDSRRPRIKKST 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 19/75 (25%)
RRM 128..202 CDD:214636 17/100 (17%)
zcrb1NP_001107973.1 RRM_ZCRB1 9..86 CDD:240839 20/76 (26%)
PTZ00368 <97..123 CDD:173561 4/25 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.