DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DNAJB9 and CG3061

DIOPT Version :9

Sequence 1:NP_036460.1 Gene:DNAJB9 / 4189 HGNCID:6968 Length:223 Species:Homo sapiens
Sequence 2:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster


Alignment Length:142 Identity:51/142 - (35%)
Similarity:76/142 - (53%) Gaps:16/142 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    25 KSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTL 89
            |.||::|||.|:|::.:||||:.|||::.||||||:|.|...|:.:..|...|:||.:||.||..
  Fly   105 KDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFKALGNAAGVLTDAEKRKNYDLY 169

Human    90 GHSAFTSGKGQRGSG---------SSFEQSFNFNFD----DLFKDF---GFFGQNQNTGSKKRFE 138
            |.:...:|.|..|.|         :.:..|..|..|    :||..|   ||..||.:...::|.:
  Fly   170 GINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELFNMFFNGGFPQQNVHMRQQRRRQ 234

Human   139 NHFQTRQDGGSS 150
            ...:.|:...||
  Fly   235 QAREDREGNNSS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DNAJB9NP_036460.1 type 2 signal-anchor for ER localization 7..23
DnaJ 26..>136 CDD:333066 46/125 (37%)
Divergent targeting domain. /evidence=ECO:0000250|UniProtKB:Q9QYI6 91..223 18/76 (24%)
CG3061NP_650328.1 DnaJ 105..>224 CDD:223560 45/118 (38%)
DnaJ 106..167 CDD:278647 29/60 (48%)
DUF1977 269..366 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1173544at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.