DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh6 and OPN1MW2

DIOPT Version :9

Sequence 1:NP_524368.5 Gene:Rh6 / 41889 FlyBaseID:FBgn0019940 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001041646.1 Gene:OPN1MW2 / 728458 HGNCID:26952 Length:364 Species:Homo sapiens


Alignment Length:398 Identity:103/398 - (25%)
Similarity:171/398 - (42%) Gaps:72/398 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASLHPPS----------FAYMR--------DGRNLSLAESVPAEIMHMVDPYWYQWPPLEPMWF 47
            :|..||..          |.|..        :|.|..:|   |..:.|           |..:| 
Human    10 LAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIA---PRWVYH-----------LTSVW- 59

  Fly    48 GIIGFVIAILGTMSLAGNFIVMYIFTSSKGLRTPSNMFVVNLAFSDFMMMFTMFPPVVLNGFYGT 112
             :|..|||     |:..|.:|:......|.||.|.|..:||||.:|...........|:|..||.
Human    60 -MIFVVIA-----SVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISVVNQVYGY 118

  Fly   113 WIMGPFLCELYGMFGSLFGCVSIWSMTLIAYDRYCVIVKGMARKPLTATAAVLRLMVVWTICGAW 177
            :::|..:|.|.|...||.|...:||:.:|:::|:.|:.|........|..|::.:...|.....|
Human   119 FVLGHPMCVLEGYTVSLCGITGLWSLAIISWERWMVVCKPFGNVRFDAKLAIVGIAFSWIWAAVW 183

  Fly   178 ALMPLFGWNRYVPEGNMTACGTDYFAKDWWN--RSYIIVYSLWVYLTPLLTIIFSY---WHIMKA 237
            ...|:|||:||.|.|..|:||.|.|:...:.  :||:||..:...:|||..|:..|   |..::|
Human   184 TAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMVTCCITPLSIIVLCYLQVWLAIRA 248

  Fly   238 VAAHEKAMREQAKKMNVASLRNSEADKSKAIEIKLAKVALTTISLWFFAWTPYTIIN-YAGIFES 301
            ||..:|                 |::.::..|.::.::.:..:..:.|.|.||.... :|.....
Human   249 VAKQQK-----------------ESESTQKAEKEVTRMVVVMVLAFCFCWGPYAFFACFAAANPG 296

  Fly   302 MHLSPLSTICGSVFAKANAVCNPIVYGLSHPKYKQVLREKMPCLACGK--DD---LTSDSRTQAT 361
            ....||.....:.|||:..:.||::|...:.:::..:.:..     ||  ||   |:|.|:|:.:
Human   297 YPFHPLMAALPAFFAKSATIYNPVIYVFMNRQFRNCILQLF-----GKKVDDGSELSSASKTEVS 356

  Fly   362 AEISESQA 369
            :..|.|.|
Human   357 SVSSVSPA 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh6NP_524368.5 7tmA_photoreceptors_insect 48..338 CDD:320207 80/295 (27%)
TM helix 1 50..74 CDD:320207 7/23 (30%)
TM helix 2 83..105 CDD:320207 6/21 (29%)
TM helix 3 121..143 CDD:320207 8/21 (38%)
TM helix 4 165..181 CDD:320207 2/15 (13%)
TM helix 5 209..232 CDD:320207 9/25 (36%)
TM helix 6 273..295 CDD:320207 4/22 (18%)
TM helix 7 306..331 CDD:320207 8/24 (33%)
OPN1MW2NP_001041646.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 3/12 (25%)
Required for 11-cis-retinal regeneration. /evidence=ECO:0000269|PubMed:30948514 17..43 2/25 (8%)
7tm_4 61..>178 CDD:304433 36/121 (30%)
7tm_1 71..322 CDD:278431 74/267 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X120
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.