DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh6 and opn3

DIOPT Version :9

Sequence 1:NP_524368.5 Gene:Rh6 / 41889 FlyBaseID:FBgn0019940 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001104634.1 Gene:opn3 / 561815 ZFINID:ZDB-GENE-080227-16 Length:387 Species:Danio rerio


Alignment Length:313 Identity:87/313 - (27%)
Similarity:154/313 - (49%) Gaps:20/313 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FGIIGFVIAILGTMSLAGNFIVMYIFTSSKGLRTPSNMFVVNLAFSDFMMMFTMFPPVVLNGFYG 111
            :.::.|.|..:|.:....|.||:.:::..|.||||:|:.:||::.||.::..|......::....
Zfish    25 YKLLTFTIGSIGVLGFCNNIIVIILYSRYKRLRTPTNLLIVNISVSDLLVSLTGVNFTFVSCVKR 89

  Fly   112 TWIMGPFLCELYGMFGSLFGCVSIWSMTLIAYDRYCVIVKGMARKPLTATAAVLRLMVVWTICGA 176
            .|:.....|...|...||||.|||.:::.:||:||..:|..   |.:....|...:..:|....|
Zfish    90 RWVFNSATCVWDGFSNSLFGIVSIMTLSGLAYERYIRVVHA---KVVDFPWAWRAITHIWLYSLA 151

  Fly   177 WALMPLFGWNRYVPEGNMTACGTDYFAKDWWNRSYIIVYSLWVYLTPLLTIIFSYWHIMKAVAAH 241
            |...||.|||||..|.:...|..|:.:||..:.|:|:.:.|..:..|:..:::.|.:|:..|   
Zfish   152 WTGAPLLGWNRYTLEVHQLGCSLDWASKDPNDASFILFFLLGCFFVPVGVMVYCYGNILYTV--- 213

  Fly   242 EKAMREQAKKMNVASLRNSEADKSKAIEIKLAKVALTTISLWFFAWTPYTIINYAGIF-ESMHLS 305
             |.:|      ::..|:..:..|....|.|:|.:.|..||.:...||||.:::....| :...:|
Zfish   214 -KMLR------SIQDLQTVQTIKILRYEKKVAVMFLMMISCFLVCWTPYAVVSMLEAFGKKSVVS 271

  Fly   306 PLSTICGSVFAKANAVCNPIVYGLSHPKYKQVLREKMPCLACGKDDLTSDSRT 358
            |...|..|:|||::...||::|.....|:::.:.:    :.|.:  |||...|
Zfish   272 PTVAIIPSLFAKSSTAYNPVIYAFMSRKFRRCMLQ----MLCSR--LTSLQHT 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh6NP_524368.5 7tmA_photoreceptors_insect 48..338 CDD:320207 82/290 (28%)
TM helix 1 50..74 CDD:320207 6/23 (26%)
TM helix 2 83..105 CDD:320207 6/21 (29%)
TM helix 3 121..143 CDD:320207 8/21 (38%)
TM helix 4 165..181 CDD:320207 3/15 (20%)
TM helix 5 209..232 CDD:320207 4/22 (18%)
TM helix 6 273..295 CDD:320207 8/21 (38%)
TM helix 7 306..331 CDD:320207 9/24 (38%)
opn3NP_001104634.1 7tm_1 43..293 CDD:278431 77/262 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.