DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh6 and valopb

DIOPT Version :9

Sequence 1:NP_524368.5 Gene:Rh6 / 41889 FlyBaseID:FBgn0019940 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001103750.1 Gene:valopb / 560921 ZFINID:ZDB-GENE-040724-41 Length:392 Species:Danio rerio


Alignment Length:328 Identity:84/328 - (25%)
Similarity:158/328 - (48%) Gaps:31/328 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SLAESVPAEIMHMVDPYWYQWPPLEPMWFGIIGFVIAILGTMSLAGNFIVMYIFTSSKGLRTPSN 83
            |:.||  .::....||:......:.|..:..:..::.|:.::|:..||.||.:....|.||.|.|
Zfish     7 SVTES--TDVTTPDDPFKGPLKSVAPWNYTFLACLMFIVTSLSITENFTVMLVTYRFKQLRKPLN 69

  Fly    84 MFVVNLAFSDFMMMFTMFPPVVLNGFYGTWIMGPFLCELYGMFGSLFGCVSIWSMTLIAYDRYCV 148
            ..:|||:.:||::..|......|....|.:.:|.:.|.|.|...:.||.|::||:.::|::|:.|
Zfish    70 YIIVNLSVADFLVSMTGGTISFLTNARGFFFLGVWACVLEGFAVTFFGIVALWSLAILAFERFFV 134

  Fly   149 IVKGMARKPLTATAAVLRLMVVWTICGAWALMPLFGWNRYVPEGNMTACGTDYFAKDWWNRSYII 213
            |.:.:....|....|.:.|:.|||....|.:.|:.|||.|......|.|..::::.::::.:|||
Zfish   135 ICRPLKNVRLGGKHAAMGLIFVWTFSFIWTIPPVLGWNSYTVSKIGTTCEPNWYSTNYYDHTYII 199

  Fly   214 VYSLWVYLTPLLTIIFSYWHIMKAVAAHEKAMREQAKKMNVASLRNSEADKSKAIEIKLAKVALT 278
            .:.:..::.||..||.||..:|              :|:...|..:.....::..:.::|::.:.
Zfish   200 TFFVTCFILPLGVIIISYGKLM--------------QKLRKVSNTHGRLGNARKPDREVARMVVV 250

  Fly   279 TISLWFFAWTPYTIINYAGIFESMHLSPLSTI-----CGSV---FAKANAVCNPIVYGLSHPKYK 335
            .|..:...||||...       |:.::...||     .||:   |:|..||.|||:|...:.:::
Zfish   251 MIVAFMVGWTPYAAF-------SITVTACPTIYIDPRLGSIPAFFSKTAAVYNPIIYVFMNKQFR 308

  Fly   336 QVL 338
            :.|
Zfish   309 KCL 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh6NP_524368.5 7tmA_photoreceptors_insect 48..338 CDD:320207 77/297 (26%)
TM helix 1 50..74 CDD:320207 6/23 (26%)
TM helix 2 83..105 CDD:320207 7/21 (33%)
TM helix 3 121..143 CDD:320207 7/21 (33%)
TM helix 4 165..181 CDD:320207 5/15 (33%)
TM helix 5 209..232 CDD:320207 8/22 (36%)
TM helix 6 273..295 CDD:320207 6/21 (29%)
TM helix 7 306..331 CDD:320207 12/32 (38%)
valopbNP_001103750.1 7tm_4 38..315 CDD:304433 78/295 (26%)
7tm_1 50..300 CDD:278431 74/270 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X120
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.