DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh6 and rrh

DIOPT Version :9

Sequence 1:NP_524368.5 Gene:Rh6 / 41889 FlyBaseID:FBgn0019940 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001004654.1 Gene:rrh / 447916 ZFINID:ZDB-GENE-040912-94 Length:334 Species:Danio rerio


Alignment Length:298 Identity:71/298 - (23%)
Similarity:141/298 - (47%) Gaps:15/298 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 IIGFVIAILGTMSLAGNFIVMYIFTSSKGLRTPSNMFVVNLAFSDFMMMFTMFPPVVLNGFYGTW 113
            |:...:...|.:||:.|.:|:.:|...:.|||.:|..::||||:|..:....:|....:..:|:|
Zfish    27 IVAAYLITAGVISLSSNIVVLLMFVKFRELRTATNAIIINLAFTDIGVAGIGYPMSAASDLHGSW 91

  Fly   114 IMGPFLCELYGMFGSLFGCVSIWSMTLIAYDRYCVIVKGMARKPLTATAAVLRLMVVWTICGAWA 178
            ..|...|::|......||..||..:|::|.|||..|.:....:.||..:..|.::..|.....|:
Zfish    92 KFGYMGCQIYAALNIFFGMASIGLLTVVAIDRYLTICRPDIGQKLTTRSYTLLIVAAWLNAVFWS 156

  Fly   179 LMPLFGWNRYVPEGNMTACGTDYFAKDWWNRSYIIVYSLWVYLTPLLTIIFSYWHIMKAVAAHEK 243
            .||:.||..|.|:.....|..::...|....||.:......::.||..:.:.|:::...|     
Zfish   157 SMPIVGWAGYAPDPTGATCTINWRNNDTSFVSYTMTVITVNFIIPLSVMFYCYYNVSATV----- 216

  Fly   244 AMREQAKKMNVASLRNS-EADKSKAIEIKLAKVALTTISLWFFAWTPYTII-NYAGIFESMHLSP 306
                  |:...::..:| ..|.|..:::  .|:::..|.::..||:||:|: .:|...:...:..
Zfish   217 ------KRFKASNCLDSINMDWSDQMDV--TKMSVIMIVMFLAAWSPYSIVCLWASFGDPQKIPA 273

  Fly   307 LSTICGSVFAKANAVCNPIVYGLSHPKYKQVLREKMPC 344
            ...|...:.||::...||.:|.:::.|:::.:...:.|
Zfish   274 PMAIIAPLLAKSSTFYNPCIYVIANKKFRRAIIGMIRC 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh6NP_524368.5 7tmA_photoreceptors_insect 48..338 CDD:320207 70/290 (24%)
TM helix 1 50..74 CDD:320207 6/23 (26%)
TM helix 2 83..105 CDD:320207 7/21 (33%)
TM helix 3 121..143 CDD:320207 6/21 (29%)
TM helix 4 165..181 CDD:320207 3/15 (20%)
TM helix 5 209..232 CDD:320207 4/22 (18%)
TM helix 6 273..295 CDD:320207 7/22 (32%)
TM helix 7 306..331 CDD:320207 6/24 (25%)
rrhNP_001004654.1 7tm_1 43..294 CDD:278431 64/263 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48050
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.