DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh6 and Rh3

DIOPT Version :9

Sequence 1:NP_524368.5 Gene:Rh6 / 41889 FlyBaseID:FBgn0019940 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_524411.1 Gene:Rh3 / 42398 FlyBaseID:FBgn0003249 Length:383 Species:Drosophila melanogaster


Alignment Length:356 Identity:123/356 - (34%)
Similarity:204/356 - (57%) Gaps:10/356 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LAESVPAEIMHMVDPYWYQWP-PLEPMWFGIIGFVIAILGTMSLAGNFIVMYIFTSSKGLRTPSN 83
            |..:||.|.:..:..:|..:| |.|.|.: ::|.:......||:.||.:|:::|:::|.||||||
  Fly    31 LGWNVPPEELRHIPEHWLTYPEPPESMNY-LLGTLYIFFTLMSMLGNGLVIWVFSAAKSLRTPSN 94

  Fly    84 MFVVNLAFSDFMMMFTMFPPVVLNGFYGTWIMGPFLCELYGMFGSLFGCVSIWSMTLIAYDRYCV 148
            :.|:||||.||||| ...|..:.|.|:..:.:|...|:::|:.||..|..:..:...|||||:.|
  Fly    95 ILVINLAFCDFMMM-VKTPIFIYNSFHQGYALGHLGCQIFGIIGSYTGIAAGATNAFIAYDRFNV 158

  Fly   149 IVKGMARKPLTATAAVLRLMVVWTICGAWALMPLF-GWNRYVPEGNMTACGTDYFAKDWWNRSYI 212
            |.:.|..| :|...|:..::.::.....|.:.... .|.|:||||.:|:|..||...::..|.::
  Fly   159 ITRPMEGK-MTHGKAIAMIIFIYMYATPWVVACYTETWGRFVPEGYLTSCTFDYLTDNFDTRLFV 222

  Fly   213 IVYSLWVYLTPLLTIIFSYWHIMKAVAAHEKAMREQAKKMNVASLRNSEADKSK-AIEIKLAKVA 276
            .....:.::.|...|.:.|..|:..|.:||||:|:|||||||.||| |..||:| ..||::||.|
  Fly   223 ACIFFFSFVCPTTMITYYYSQIVGHVFSHEKALRDQAKKMNVESLR-SNVDKNKETAEIRIAKAA 286

  Fly   277 LTTISLWFFAWTPYTIINYAGIF-ESMHLSPLSTICGSVFAKANAVCNPIVYGLSHPKYKQVLRE 340
            :|...|:|.:||||.:::..|.| :...|:|.:|:..:...|..|..:|.||.:|||:|:..|::
  Fly   287 ITICFLFFCSWTPYGVMSLIGAFGDKTLLTPGATMIPACACKMVACIDPFVYAISHPRYRMELQK 351

  Fly   341 KMPCLACGK--DDLTSDSRTQATAEISESQA 369
            :.|.||..:  .:.::.:.|..|.|..::.|
  Fly   352 RCPWLALNEKAPESSAVASTSTTQEPQQTTA 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh6NP_524368.5 7tmA_photoreceptors_insect 48..338 CDD:320207 106/292 (36%)
TM helix 1 50..74 CDD:320207 7/23 (30%)
TM helix 2 83..105 CDD:320207 12/21 (57%)
TM helix 3 121..143 CDD:320207 5/21 (24%)
TM helix 4 165..181 CDD:320207 1/15 (7%)
TM helix 5 209..232 CDD:320207 3/22 (14%)
TM helix 6 273..295 CDD:320207 10/21 (48%)
TM helix 7 306..331 CDD:320207 7/24 (29%)
Rh3NP_524411.1 7tm_4 66..>191 CDD:304433 44/126 (35%)
7tm_1 75..338 CDD:278431 97/265 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461669
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I3575
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6356
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24240
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X120
65.990

Return to query results.
Submit another query.