DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh6 and Opn5

DIOPT Version :9

Sequence 1:NP_524368.5 Gene:Rh6 / 41889 FlyBaseID:FBgn0019940 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_861418.2 Gene:Opn5 / 353344 MGIID:2662912 Length:377 Species:Mus musculus


Alignment Length:339 Identity:96/339 - (28%)
Similarity:148/339 - (43%) Gaps:46/339 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 IIGFVIAILGTMSLAGNFIVMYIFTSSKGLRTPSNMFVVNLAFSDFMMMFTMFPPVVLNGFYGTW 113
            :.||.:.|:|.:|..||..|:|:.:..|....|:.:..:|||..|..:.....|..:::.|...|
Mouse    35 VAGFYLTIIGILSTFGNGYVLYMSSRRKKKLRPAEIMTINLAVCDLGISVVGKPFTIISCFCHRW 99

  Fly   114 IMGPFLCELYGMFGSLFGCVSIWSMTLIAYDRY---CVIVKG--MARKPLTATAAVLRLMVVWTI 173
            :.|.|.|..||..|..|||.|:.:||.::.|||   |.:..|  :.||     .|.:.|.|:|..
Mouse   100 VFGWFGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICYLSYGVWLKRK-----HAYICLAVIWAY 159

  Fly   174 CGAWALMPLFGWNRYVPEGNMTACGTDYFAKDWW-------NRSYIIVYSLWVYLTPLLTIIFSY 231
            ...|..|||.|...|.||...|:|     ..|||       .:.:|:....:..|.|...|:|||
Mouse   160 ASFWTTMPLVGLGDYAPEPFGTSC-----TLDWWLAQASGGGQVFILSILFFCLLLPTAVIVFSY 219

  Fly   232 WHIMKAVAAHEKAMREQAKKMNVASLRNSEADKSKAIEIKLAKVALTTISLWFFAWTPYTIINYA 296
            ..|:..|.:..|         .||.. :|....|..:|:||.|||:...:.:..||.||.:::..
Mouse   220 AKIIAKVKSSSK---------EVAHF-DSRIHSSHVLEVKLTKVAMLICAGFLIAWIPYAVVSVW 274

  Fly   297 GIFESMHLSPLS-TICGSVFAKANAVCNPIVYGLSHPKYKQVLREKMPCLACG-----KDDLTSD 355
            ..|......|:. ::..::.||:.|:.|||:|        ||:..:..|...|     |.....|
Mouse   275 SAFGRPDSIPIQLSVVPTLLAKSAAMYNPIIY--------QVIDYRFACCQAGGLRGTKKKSLED 331

  Fly   356 SRTQATAEISESQA 369
            .|......:.:|.|
Mouse   332 FRLHTVTAVRKSSA 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh6NP_524368.5 7tmA_photoreceptors_insect 48..338 CDD:320207 88/301 (29%)
TM helix 1 50..74 CDD:320207 9/23 (39%)
TM helix 2 83..105 CDD:320207 5/21 (24%)
TM helix 3 121..143 CDD:320207 9/21 (43%)
TM helix 4 165..181 CDD:320207 4/15 (27%)
TM helix 5 209..232 CDD:320207 6/22 (27%)
TM helix 6 273..295 CDD:320207 7/21 (33%)
TM helix 7 306..331 CDD:320207 8/25 (32%)
Opn5NP_861418.2 7tm_1 50..306 CDD:278431 81/275 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..377
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.