DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh6 and Rh5

DIOPT Version :9

Sequence 1:NP_524368.5 Gene:Rh6 / 41889 FlyBaseID:FBgn0019940 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001285859.1 Gene:Rh5 / 34615 FlyBaseID:FBgn0014019 Length:382 Species:Drosophila melanogaster


Alignment Length:369 Identity:124/369 - (33%)
Similarity:198/369 - (53%) Gaps:20/369 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AYMR----DGRNLSLAESVPAEIMHMVDPYW--YQWPPLEPMWFGIIGFVIAILGTM--SLAGNF 66
            ||:.    ||....:....|||..|||..:|  ::..|:    :...||.||.:..|  |:.||.
  Fly    11 AYVNDSLGDGSVFPMGHGYPAEYQHMVHAHWRGFREAPI----YYHAGFYIAFIVLMLSSIFGNG 71

  Fly    67 IVMYIFTSSKGLRTPSNMFVVNLAFSDFMMMFTMFPPVVLNGFYGTWIMGPFLCELYGMFGSLFG 131
            :|::||::||.||||||:.::|||..| :.|.|..|..::|...|..:.|...|::|.:.|.:.|
  Fly    72 LVIWIFSTSKSLRTPSNLLILNLAIFD-LFMCTNMPHYLINATVGYIVGGDLGCDIYALNGGISG 135

  Fly   132 CVSIWSMTLIAYDRYCVIVKGMARKPLTATAAVLRLMVVWTICGAWALMPLFG-WNRYVPEGNMT 195
            ..:..:...||:|||..|...:..: |:....||.::..|.....::::|||. |.||.|||.:|
  Fly   136 MGASITNAFIAFDRYKTISNPIDGR-LSYGQIVLLILFTWLWATPFSVLPLFQIWGRYQPEGFLT 199

  Fly   196 ACGTDYFAKDWWNRSYIIVYSLWVYLTPLLTIIFSYWHIMKAVAAHEKAMREQAKKMNVASL-RN 259
            .|..||......||.::....:|.|:.|:..|:.||:.:...|..|||.:.||||||||.|| .|
  Fly   200 TCSFDYLTNTDENRLFVRTIFVWSYVIPMTMILVSYYKLFTHVRVHEKMLAEQAKKMNVKSLSAN 264

  Fly   260 SEADKSKAIEIKLAKVALTTISLWFFAWTPYTIINYAGIF-ESMHLSPLSTICGSVFAKANAVCN 323
            :.|| :.::|:::||.||....|:..|||||:::...|.| |...::|..::...:..|:.:..:
  Fly   265 ANAD-NMSVELRIAKAALIIYMLFILAWTPYSVVALIGCFGEQQLITPFVSMLPCLACKSVSCLD 328

  Fly   324 PIVYGLSHPKYKQVLREKMPCLACGKDDLTSDSR--TQATAEIS 365
            |.||..|||||:..|..::|.|...:...||.:.  .::.|.:|
  Fly   329 PWVYATSHPKYRLELERRLPWLGIREKHATSGTSGGQESVASVS 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh6NP_524368.5 7tmA_photoreceptors_insect 48..338 CDD:320207 105/294 (36%)
TM helix 1 50..74 CDD:320207 11/25 (44%)
TM helix 2 83..105 CDD:320207 8/21 (38%)
TM helix 3 121..143 CDD:320207 4/21 (19%)
TM helix 4 165..181 CDD:320207 2/15 (13%)
TM helix 5 209..232 CDD:320207 6/22 (27%)
TM helix 6 273..295 CDD:320207 10/21 (48%)
TM helix 7 306..331 CDD:320207 5/24 (21%)
Rh5NP_001285859.1 7tm_4 60..>236 CDD:304433 59/177 (33%)
7tm_1 69..332 CDD:278431 92/265 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461672
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42416
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24240
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.