DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh6 and OPN5

DIOPT Version :9

Sequence 1:NP_524368.5 Gene:Rh6 / 41889 FlyBaseID:FBgn0019940 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_016865905.1 Gene:OPN5 / 221391 HGNCID:19992 Length:408 Species:Homo sapiens


Alignment Length:383 Identity:103/383 - (26%)
Similarity:162/383 - (42%) Gaps:75/383 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 YMRDGRNLSLAESVPAEIMHMVDPYWYQWPPLEPMWFGIIGFVIAILGTMSLAGNFIVMYIFTSS 75
            |:|||...:...|..|::                    :.||.:.|:|.:|..||..|:|:.:..
Human    17 YLRDGDPFASKLSWEADL--------------------VAGFYLTIIGILSTFGNGYVLYMSSRR 61

  Fly    76 KGLRTPSNMFVVNLAFSDFMMMFTMFPPVVLNGFYGTWIMGPFLCELYGMFGSLFGCVSIWSMTL 140
            |....|:.:..:|||..|..:.....|..:::.|...|:.|...|..||..|..|||.|:.:||.
Human    62 KKKLRPAEIMTINLAVCDLGISVVGKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTA 126

  Fly   141 IAYDRY---CVIVKG--MARKPLTATAAVLRLMVVWTICGAWALMPLFGWNRYVPEGNMTACGTD 200
            ::.|||   |.:..|  :.||     .|.:.|..:|.....|..|||.|...||||...|:|   
Human   127 VSLDRYLKICYLSYGVWLKRK-----HAYICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSC--- 183

  Fly   201 YFAKDWW-------NRSYIIVYSLWVYLTPLLTIIFSYWHIMKAVAAHEKAMREQAKKMNVASLR 258
              ..|||       .:.:|:....:..|.|...|:|||   :|.:|..:.:.:|.|.       .
Human   184 --TLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSY---VKIIAKVKSSSKEVAH-------F 236

  Fly   259 NSEADKSKAIEIKLAKVALTTISLWFFAWTPYTIINYAGIFESMHLSPLS-TICGSVFAKANAVC 322
            :|....|..:|:||.|||:...:.:..||.||.:::....|......|:. ::..::.||:.|:.
Human   237 DSRIHSSHVLEMKLTKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAMY 301

  Fly   323 NPIVYGLSHPKYKQVLREKMPCLACG------KDDL--------TSDSRTQATAEISE 366
            |||:|        ||:..|..|...|      |..|        |:..::.|..||.|
Human   302 NPIIY--------QVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIHE 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh6NP_524368.5 7tmA_photoreceptors_insect 48..338 CDD:320207 86/302 (28%)
TM helix 1 50..74 CDD:320207 9/23 (39%)
TM helix 2 83..105 CDD:320207 5/21 (24%)
TM helix 3 121..143 CDD:320207 9/21 (43%)
TM helix 4 165..181 CDD:320207 3/15 (20%)
TM helix 5 209..232 CDD:320207 6/22 (27%)
TM helix 6 273..295 CDD:320207 7/21 (33%)
TM helix 7 306..331 CDD:320207 8/25 (32%)
OPN5XP_016865905.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.