DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh6 and tmtops

DIOPT Version :9

Sequence 1:NP_524368.5 Gene:Rh6 / 41889 FlyBaseID:FBgn0019940 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001304832.1 Gene:tmtops / 100488877 XenbaseID:XB-GENE-1018915 Length:382 Species:Xenopus tropicalis


Alignment Length:280 Identity:78/280 - (27%)
Similarity:141/280 - (50%) Gaps:20/280 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VIAI-LGTMSLAG---NFIVMYIFTSSKGLRTPSNMFVVNLAFSDFMMMFTMFPPVVLNGFYGTW 113
            |:|: ||.:.:.|   |..|:.||.....:|||.||.::|::.||.::.....|...::...|.|
 Frog    38 VVAVCLGCILVLGSLYNSFVLLIFVKFTAIRTPINMILLNISVSDLLVCIFGTPFSFVSSVSGGW 102

  Fly   114 IMGPFLCELYGMFGSLFGCVSIWSMTLIAYDRYCVIVKGMARKPLTATAAVLRLMVVWTICGAWA 178
            ::|...|:.||...||||.||:.|:::::|:||..::|...........:.|.::|.|.....|.
 Frog   103 LLGQQGCKWYGFCNSLFGLVSMISLSMLSYERYLTVLKCTKADMTDYKKSWLCIIVSWLYSLCWT 167

  Fly   179 LMPLFGWNRYVPEGNMTACGTDYFAKDWWNRSYIIVYSLWVYLTPLLTIIFSYWHIMKAVAAHEK 243
            |.||.||:.|..|.:.|.|...:.:|...|.|||:...|:..:.||..:||.|.||::.:     
 Frog   168 LPPLIGWSSYGLESSGTTCSVVWHSKSSNNISYIVCLFLFCLVLPLFIMIFCYGHIVRVI----- 227

  Fly   244 AMREQAKKMNVASLRNSEADKSKAIEIKLAKVALTTISLWFFAWTPYTIINYAGIF-ESMHLSPL 307
              |.|..::|:.:.:..|.        :|..:.:..::.:...|.||.:::....| :...::|.
 Frog   228 --RGQVCRINMTTAQKREH--------RLLFMVVCMVTCYLLCWMPYGLVSLMTAFGKPGMITPT 282

  Fly   308 STICGSVFAKANAVCNPIVY 327
            .:|..|:.||::...||::|
 Frog   283 VSIIPSILAKSSTFINPLIY 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh6NP_524368.5 7tmA_photoreceptors_insect 48..338 CDD:320207 78/280 (28%)
TM helix 1 50..74 CDD:320207 9/24 (38%)
TM helix 2 83..105 CDD:320207 6/21 (29%)
TM helix 3 121..143 CDD:320207 9/21 (43%)
TM helix 4 165..181 CDD:320207 5/15 (33%)
TM helix 5 209..232 CDD:320207 8/22 (36%)
TM helix 6 273..295 CDD:320207 3/21 (14%)
TM helix 7 306..331 CDD:320207 8/22 (36%)
tmtopsNP_001304832.1 7tm_1 54..302 CDD:278431 72/262 (27%)
7tm_4 <119..319 CDD:304433 52/199 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.