DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B9d1 and mks1

DIOPT Version :9

Sequence 1:NP_650470.1 Gene:B9d1 / 41888 FlyBaseID:FBgn0038342 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001070841.2 Gene:mks1 / 556706 ZFINID:ZDB-GENE-030131-3813 Length:559 Species:Danio rerio


Alignment Length:191 Identity:40/191 - (20%)
Similarity:74/191 - (38%) Gaps:28/191 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LSIVGQIVSATFPLGPDKEFVFLRYEMVAGPDW-QLSSGPQHGLTQLATNRRGHFNEPIVFNMPI 118
            |.:.|:||||.   |.:.:.:::.:.:....:| .:||....|:||....|.....:...|:.|.
Zfish   310 LIVNGEIVSAQ---GYEYDNLYVHFFVDLPNNWSSVSSHCLSGVTQTCRTRSIEKEDVAFFSYPF 371

  Fly   119 EVT---YKSTSPYG----WPQILVTVFGRSGLGRETLLGYAHIHLP-VFGSRRPADQT-EQLQAP 174
            ...   :|.....|    ||.:...|.......|....||.::.:| ..|..|...:| ..:|. 
Zfish   372 SFETFFHKEDESDGSLPQWPVLYFKVLSLDFWQRFRTEGYGYLVIPSTSGRHRMTCRTWRAVQR- 435

  Fly   175 ILMPKCPNMMADITSWLLRREPELKDPKVLL-------DNLKCKGLSMESYGSLQFQLSSV 228
                   ..:|::..:.:...|||:|...:.       :.|...|...::.||:.|.|:.:
Zfish   436 -------GTVAELRRFFIGGAPELEDISYVRIPGTFKGERLSRFGFRTQTTGSVTFTLNCI 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B9d1NP_650470.1 B9-C2 61..226 CDD:284557 37/181 (20%)
mks1NP_001070841.2 B9-C2 316..488 CDD:284557 38/182 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.