DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B9d1 and b9d1

DIOPT Version :9

Sequence 1:NP_650470.1 Gene:B9d1 / 41888 FlyBaseID:FBgn0038342 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001019544.1 Gene:b9d1 / 554150 ZFINID:ZDB-GENE-050522-467 Length:201 Species:Danio rerio


Alignment Length:185 Identity:63/185 - (34%)
Similarity:108/185 - (58%) Gaps:11/185 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 FSLSIVGQIVSATFPLGPDKEFVFLRYEMVAGPDWQLSSGPQHGLTQLATNRRGHFNEPIVFNMP 117
            |.|.:.|||.||.|   |:.:.::.:|..|.|.||..:||.:.|::|:.:  :|..::.:|:|.|
Zfish     9 FLLMVNGQIESADF---PEYDDLYCKYCFVYGHDWAPTSGLEEGISQITS--KGRLSQSLVWNFP 68

  Fly   118 IEVTYKSTSPYGWPQILVTVFGRSGLGRETLLGYAHIHLPVFGSRRPADQTEQLQAPILMPKCPN 182
            :::|:|||:|:|||||:|:|:|....|.:.:.||..:|:|.    .|...|:.:  |:.:|:..:
Zfish    69 LDITFKSTNPFGWPQIVVSVYGPDTFGNDVVRGYGAVHIPF----TPGKHTKTI--PMFVPESTS 127

  Fly   183 MMADITSWLLRREPELKDPKVLLDNLKCKGLSMESYGSLQFQLSSVMRGARKLGY 237
            .:...||||:.|.||..||||:......:...:.|.|.:..|.:.|.:..:||||
Zfish   128 RLQKFTSWLMGRRPEFTDPKVVAQGEGREVTRVRSQGFVTLQFNIVTKDMKKLGY 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B9d1NP_650470.1 B9-C2 61..226 CDD:284557 54/164 (33%)
b9d1NP_001019544.1 B9-C2 17..172 CDD:284557 54/165 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589065
Domainoid 1 1.000 112 1.000 Domainoid score I6167
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8440
Inparanoid 1 1.050 124 1.000 Inparanoid score I4700
OMA 1 1.010 - - QHG56501
OrthoDB 1 1.010 - - D1387644at2759
OrthoFinder 1 1.000 - - FOG0006440
OrthoInspector 1 1.000 - - oto40809
orthoMCL 1 0.900 - - OOG6_104502
Panther 1 1.100 - - LDO PTHR12968
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5406
SonicParanoid 1 1.000 - - X5406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.900

Return to query results.
Submit another query.