DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B9d1 and b9d1

DIOPT Version :9

Sequence 1:NP_650470.1 Gene:B9d1 / 41888 FlyBaseID:FBgn0038342 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001016309.1 Gene:b9d1 / 549063 XenbaseID:XB-GENE-971084 Length:198 Species:Xenopus tropicalis


Alignment Length:190 Identity:65/190 - (34%)
Similarity:105/190 - (55%) Gaps:14/190 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SYFSLSIVGQIVSATFPLGPDKEF--VFLRYEMVAGPDWQLSSGPQHGLTQLATNRRGHFNEPIV 113
            |.|.|::.|||.||.||     ||  ::.:|..|.|.||..:||.:.|::|:.:..:|. .:.:|
 Frog     6 SVFLLNVSGQIESAEFP-----EFDDLYCKYSFVYGHDWAPTSGVEEGISQITSKSQGG-KQALV 64

  Fly   114 FNMPIEVTYKSTSPYGWPQILVTVFGRSGLGRETLLGYAHIHLPVFGSRRPADQTEQLQAPILMP 178
            :|.|||:|:|||:|:|||||:::|:|....|.:.:.||..:|||....|...      ..|:.:|
 Frog    65 WNFPIEITFKSTNPFGWPQIVISVYGPDAFGNDVVRGYGAVHLPFTPGRHAR------TIPMFVP 123

  Fly   179 KCPNMMADITSWLLRREPELKDPKVLLDNLKCKGLSMESYGSLQFQLSSVMRGARKLGYH 238
            :..:.:...|||.:.|.||..||||:......:...:.|.|.:....:.|.:..:||||:
 Frog   124 ESSSRLQRFTSWFMGRRPEFTDPKVVAQGEGREVTRVRSQGCVTVSFNVVTKDLKKLGYN 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B9d1NP_650470.1 B9-C2 61..226 CDD:284557 55/166 (33%)
b9d1NP_001016309.1 B9-C2 16..172 CDD:369239 55/167 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 112 1.000 Domainoid score I6134
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8440
Inparanoid 1 1.050 124 1.000 Inparanoid score I4568
OMA 1 1.010 - - QHG56501
OrthoDB 1 1.010 - - D1387644at2759
OrthoFinder 1 1.000 - - FOG0006440
OrthoInspector 1 1.000 - - otm49313
Panther 1 1.100 - - LDO PTHR12968
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5406
SonicParanoid 1 1.000 - - X5406
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.