DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B9d1 and b9d2

DIOPT Version :9

Sequence 1:NP_650470.1 Gene:B9d1 / 41888 FlyBaseID:FBgn0038342 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001002394.1 Gene:b9d2 / 436667 ZFINID:ZDB-GENE-040718-90 Length:175 Species:Danio rerio


Alignment Length:190 Identity:47/190 - (24%)
Similarity:86/190 - (45%) Gaps:29/190 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LSIVGQIVSAT-FPLGPDKEFVFLRYEMVAGPDWQLSSGPQHGLTQLATNRRGHFNEPIVFNMPI 118
            |.|:|||:.|| ||    :..:|.::.:..|..|:|.||.:.|.||:...:.|   :...::.||
Zfish     4 LHIIGQIIGATGFP----QNSLFCKWGVHTGGAWRLLSGLREGQTQVDMPQTG---DMAYWSHPI 61

  Fly   119 EVTYKSTSPYGWPQILVTVFGRSGLGRETLLGYAHIHLPVFGSRRPADQTEQLQAPILMPKCPNM 183
            ::.|.:....|||::.:.|:.:...||..|.||.:||:|      .:....:||.....|     
Zfish    62 DLHYTTKGLQGWPKLHLQVWHQDSFGRCQLYGYGYIHVP------SSPGQHRLQCVTWRP----- 115

  Fly   184 MADITSW-------LLRREPELKDPKVLLDNLKCKGLSMESYGSLQFQLSSVMRGARKLG 236
               :.||       .:...|:|:.|.::........|.....|:::.:|..::|...:.|
Zfish   116 ---LGSWQDQLSEMFVGGGPQLRSPDLIYSGADRYRLHTVGMGTVELELCIILRHFDRYG 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B9d1NP_650470.1 B9-C2 61..226 CDD:284557 40/172 (23%)
b9d2NP_001002394.1 B9-C2 10..161 CDD:284557 40/171 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.