DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B9d1 and B9d1

DIOPT Version :9

Sequence 1:NP_650470.1 Gene:B9d1 / 41888 FlyBaseID:FBgn0038342 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_006246615.1 Gene:B9d1 / 287383 RGDID:1305522 Length:233 Species:Rattus norvegicus


Alignment Length:159 Identity:56/159 - (35%)
Similarity:94/159 - (59%) Gaps:10/159 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 AKATASYFSLSIVGQIVSATFPLGPDKEFVFLRYEMVAGPDWQLSSGPQHGLTQLATNRRGHFNE 110
            |.|:.|.|.|.:.||:.||.|   |:.:.::.:|..|.|.||..::|.:.|::|:|:..: ...:
  Rat     2 AAASPSVFLLMVNGQVESAQF---PEYDDLYCKYCFVYGQDWAPTAGLEEGISQIASKSQ-DVRQ 62

  Fly   111 PIVFNMPIEVTYKSTSPYGWPQILVTVFGRSGLGRETLLGYAHIHLPVFGSRRPADQTEQLQAPI 175
            .:|:|.||:||:|||:|||||||:::|:|....|.:.:.||..:|:|....|      .:...|:
  Rat    63 ALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPFSPGR------HKRTIPM 121

  Fly   176 LMPKCPNMMADITSWLLRREPELKDPKVL 204
            .:|:..:.:...|||.:.|.||..||||:
  Rat   122 FVPESTSTLQKFTSWFMGRRPEYTDPKVV 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B9d1NP_650470.1 B9-C2 61..226 CDD:284557 49/144 (34%)
B9d1XP_006246615.1 B9-C2 17..159 CDD:284557 47/141 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347462
Domainoid 1 1.000 105 1.000 Domainoid score I6527
eggNOG 1 0.900 - - E1_KOG4027
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8440
Inparanoid 1 1.050 119 1.000 Inparanoid score I4692
OMA 1 1.010 - - QHG56501
OrthoDB 1 1.010 - - D1387644at2759
OrthoFinder 1 1.000 - - FOG0006440
OrthoInspector 1 1.000 - - oto98456
orthoMCL 1 0.900 - - OOG6_104502
Panther 1 1.100 - - LDO PTHR12968
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5406
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.