DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B9d1 and B9d1

DIOPT Version :9

Sequence 1:NP_650470.1 Gene:B9d1 / 41888 FlyBaseID:FBgn0038342 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_038745.1 Gene:B9d1 / 27078 MGIID:1351471 Length:204 Species:Mus musculus


Alignment Length:192 Identity:64/192 - (33%)
Similarity:108/192 - (56%) Gaps:10/192 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 AKATASYFSLSIVGQIVSATFPLGPDKEFVFLRYEMVAGPDWQLSSGPQHGLTQLATNRRGHFNE 110
            |.|:.|.|.|.|.||:.||.|   |:.:.::.:|..|.|.||..::|.:.|::|:|:..: ...:
Mouse     2 AAASPSVFLLMITGQVESAQF---PEYDDLYCKYCFVYGQDWAPTAGLEEGISQIASKSQ-DVRQ 62

  Fly   111 PIVFNMPIEVTYKSTSPYGWPQILVTVFGRSGLGRETLLGYAHIHLPVFGSRRPADQTEQLQAPI 175
            .:|:|.||:||:|||:|||||||:::|:|....|.:.:.||..:|:|:...|      .:...|:
Mouse    63 ALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPLSPGR------HKRTIPM 121

  Fly   176 LMPKCPNMMADITSWLLRREPELKDPKVLLDNLKCKGLSMESYGSLQFQLSSVMRGARKLGY 237
            .:|:..:.:...|||.:.|.||..||||:......:...:.|.|.:....:.|.:..:||||
Mouse   122 FVPESTSTLQKFTSWFMGRRPEYTDPKVVAQGEGREVTRVRSQGFVTLLFNVVTKDMKKLGY 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B9d1NP_650470.1 B9-C2 61..226 CDD:284557 51/164 (31%)
B9d1NP_038745.1 B9-C2 17..173 CDD:284557 49/155 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844102
Domainoid 1 1.000 107 1.000 Domainoid score I6505
eggNOG 1 0.900 - - E1_KOG4027
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8440
Inparanoid 1 1.050 121 1.000 Inparanoid score I4754
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56501
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006440
OrthoInspector 1 1.000 - - oto94953
orthoMCL 1 0.900 - - OOG6_104502
Panther 1 1.100 - - LDO PTHR12968
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5406
SonicParanoid 1 1.000 - - X5406
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.