DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B9d1 and mks-1

DIOPT Version :9

Sequence 1:NP_650470.1 Gene:B9d1 / 41888 FlyBaseID:FBgn0038342 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001366806.1 Gene:mks-1 / 187903 WormBaseID:WBGene00020100 Length:458 Species:Caenorhabditis elegans


Alignment Length:138 Identity:27/138 - (19%)
Similarity:48/138 - (34%) Gaps:36/138 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KKSRSAKESVPNAMDAKATASYFSLSIVGQIVSATFPLGPDKEFVF-----------------LR 78
            :|:|::..|:|.:....|...    .:|..:|......|.:  |:|                 |:
 Worm   211 RKARASVTSIPESETFMAARD----GLVETVVHVKLIKGVN--FLFDEGLTIDYKLQMPRGIKLK 269

  Fly    79 YEMVAGPDWQLSSGPQHGLTQLATNRRGHFNEPIVFNMPIEVTYKSTSPYGWPQILVTVFGRSGL 143
            .|...|...:.||..|.|         |..|    |...:|..::|.:....|.:::........
 Worm   270 SENATGRSQRYSSAEQDG---------GDIN----FGYFLEFVFESRNTDFCPLLMLRFMAVDYW 321

  Fly   144 GRETLLGY 151
            ||:.:.||
 Worm   322 GRQYIAGY 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B9d1NP_650470.1 B9-C2 61..226 CDD:284557 21/108 (19%)
mks-1NP_001366806.1 B9-C2 238..397 CDD:399858 21/107 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.