DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B9d1 and mksr-1

DIOPT Version :9

Sequence 1:NP_650470.1 Gene:B9d1 / 41888 FlyBaseID:FBgn0038342 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_508203.1 Gene:mksr-1 / 186954 WormBaseID:WBGene00019364 Length:229 Species:Caenorhabditis elegans


Alignment Length:175 Identity:40/175 - (22%)
Similarity:81/175 - (46%) Gaps:16/175 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LSIVGQIVSATFPLGPDKEFVFLRYEMVAGPDWQLSSGPQHGLTQLATNRRGHFNEPIVFNMPIE 119
            |:|.|.:.:..|   |::..|.::...||..||::.:|....|:..:.  ||..|: |..::|.|
 Worm     9 LTIHGNVRTTEF---PEESNVCVKLSTVATGDWKIINGETVSLSSFSF--RGADNQ-IFIDLPFE 67

  Fly   120 VTYKSTSPYGWPQILVTVFGRSGLGRETLLGYAHIHLPVFGSRRPADQTEQLQAPILMPKCPNMM 184
            ...|.:||:.||::::..|.:...|::.:.||..:.:|.    .|.....::..  .:|:..:.:
 Worm    68 CGLKGSSPFMWPRLVLNCFSKDHSGKDCVTGYGMLPIPT----EPGKHVCRVHC--FLPEPSSTV 126

  Fly   185 ADITSWLLRREPELKDPKVLLD---NLKCKGLSMESYGSLQFQLS 226
            ..:.:.|.|...|..||.:..:   ...|: .|.:.|..|:..:|
 Worm   127 QQLIAKLRRVNAEFVDPMLPANADGRYACR-TSTKGYVDLEINVS 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B9d1NP_650470.1 B9-C2 61..226 CDD:284557 36/167 (22%)
mksr-1NP_508203.1 B9-C2 15..169 CDD:284557 36/166 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163160
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4027
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8440
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56501
OrthoDB 1 1.010 - - D1387644at2759
OrthoFinder 1 1.000 - - FOG0006440
OrthoInspector 1 1.000 - - oto20784
orthoMCL 1 0.900 - - OOG6_104502
Panther 1 1.100 - - LDO PTHR12968
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5406
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.750

Return to query results.
Submit another query.