DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdamTS-A and wfikkn2b

DIOPT Version :9

Sequence 1:NP_996218.1 Gene:AdamTS-A / 41887 FlyBaseID:FBgn0286071 Length:1688 Species:Drosophila melanogaster
Sequence 2:XP_699239.1 Gene:wfikkn2b / 570642 ZFINID:ZDB-GENE-110414-1 Length:563 Species:Danio rerio


Alignment Length:191 Identity:41/191 - (21%)
Similarity:59/191 - (30%) Gaps:72/191 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly  1173 WVLSEWSTCSKSCGTGSQQREAHCYLHNSRVSDDLCNPRTKPHLNTLIGICNTESCPTYTKSPNA 1237
            || ...|||.:.|.|                 |..|.|..|...|    :|.:.||         
Zfish    52 WV-DAMSTCKRECQT-----------------DQECEPLEKCCAN----VCGSRSC--------- 85

  Fly  1238 LAVSNWVIGEWGECNEWCEKTRSVSCSHPYGIGCGSRKPKDVRKCCHIKYTSDWTDCSVQCGEGV 1302
              |:...|...|:             ..|.|:      ||:. .|.....|...::|.::.|:.|
Zfish    86 --VAARYIDTTGK-------------KGPMGM------PKEA-SCDQFMCTQQGSECDIRDGQPV 128

  Fly  1303 KRKKQSCTRVYKPDVP-----GTRKRRVYVDESYC---ISRKVHRPKLRTTTKSCRINCKW 1355
            .:.:..|.|  :|...     .|...:.|:|...|   ||..|         .|||.:..|
Zfish   129 CKCRDRCER--EPQFTCASDGMTYYNKCYMDAEACSKGISLSV---------VSCRFHLSW 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdamTS-ANP_996218.1 Pep_M12B_propep 286..394 CDD:279848
ZnMc_ADAMTS_like 455..655 CDD:239801
Reprolysin 457..655 CDD:279729
Salp15 <696..745 CDD:288931
TSP1 754..806 CDD:214559
ADAM_spacer1 937..1042 CDD:283607
TSP1 1172..1229 CDD:214559 14/55 (25%)
GON 1495..1687 CDD:285848
wfikkn2bXP_699239.1 WAP 41..87 CDD:278522 15/67 (22%)
KAZAL_FS 135..171 CDD:238052 10/46 (22%)
I-set 207..298 CDD:254352
Ig 221..298 CDD:299845
Kunitz_BPTI 317..367 CDD:278443
Kunitz_BPTI 375..425 CDD:278443
NTR_like 443..551 CDD:295338
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.