DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdamTS-A and col28a1a

DIOPT Version :9

Sequence 1:NP_996218.1 Gene:AdamTS-A / 41887 FlyBaseID:FBgn0286071 Length:1688 Species:Drosophila melanogaster
Sequence 2:NP_001334976.1 Gene:col28a1a / 555428 ZFINID:ZDB-GENE-070705-84 Length:1170 Species:Danio rerio


Alignment Length:470 Identity:83/470 - (17%)
Similarity:143/470 - (30%) Gaps:180/470 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   457 LEVLIAVDNS----------MKQF------H----------GEDLQPYILILMSIVSSIFADASI 495
            ||::..:|:|          :|.|      |          |..|..::.::::.:..::..|::
Zfish   801 LELVFVIDSSESVGPDNYEVVKDFVNSLIDHVSVSREATRVGVVLYSHVEVVVASLQQLYDQAAV 865

  Fly   496 GNSIRILLVRLISLPNINDQTHSSNEMLKHFCQFINQSGYERDTAMLIT------REPICGSVPG 554
            ..::|       .:|.:.:.|.:.:.:.:....|.......|..|:::|      |:.:......
Zfish   866 KTAVR-------RMPYLGEGTFTGSAIRRATQLFQAARPGVRKVAVVLTDGLADNRDAVSLKDAA 923

  Fly   555 KICHMLGLA--ELGTVCSSSSCSIVQDTGLPTAFTMAHELGHILNMNHDDDDKCMPYVT------ 611
            :..|..|:.  .:|.|.:|.|              ...|..:.:|:...|.|:...|:|      
Zfish   924 EGAHSAGIEIFVVGIVNNSDS--------------QYAEFKNEMNILASDPDENYVYLTDDFLKL 974

  Fly   612 ------------RQNNNKVLHIMSSVMGIHMHPW--------SWSKCSRHFVSEFLEKTDKSCLE 656
                        ..:|.||.    |..|..:||:        :....|.:|::|..|.|.     
Zfish   975 HALESRLLNHICEHDNGKVF----SSSGKTIHPFGPDPVPDRTEPPTSDYFITEGKEDTP----- 1030

  Fly   657 TSVGAHIPYGTERLPGEIYSLDAQCQLSFGNDFGYCPTDEECKRLWCNRTSGNSNEQCASSNLPW 721
                   |...|.||.:                   |.|.:...:..:...|:.||      :||
Zfish  1031 -------PIDFETLPQQ-------------------PEDYDDIHIDTSYFDGSVNE------IPW 1063

  Fly   722 ADGTPCGSSGHWCQRGKCVSNKHGYGRQVNGGWGPWTPFTPCSLTCGGGVQESR---RECNQPVP 783
            ...||.|:..........|              ||.||..      ...||||.   :....|.|
Zfish  1064 VTETPDGNKTRQQSSISVV--------------GPQTPIN------WHHVQESSPPPKTLQPPHP 1108

  Fly   784 ENGGKYCTGSRKKYRSCNTHQCPPGS---------MDPREQQC----YAMNGRNMNIPGVNPDTK 835
            :|.        .|:..|. ....||.         .||:...|    |.....|.|         
Zfish  1109 DNS--------LKHVGCG-QGLDPGPCREYSVMWYYDPQANACAQFWYGGCQGNSN--------- 1155

  Fly   836 WVPKYE-KDACKLFC 849
               ::| :|.||..|
Zfish  1156 ---RFETEDICKSTC 1167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdamTS-ANP_996218.1 Pep_M12B_propep 286..394 CDD:279848
ZnMc_ADAMTS_like 455..655 CDD:239801 42/257 (16%)
Reprolysin 457..655 CDD:279729 42/257 (16%)
Salp15 <696..745 CDD:288931 9/48 (19%)
TSP1 754..806 CDD:214559 13/54 (24%)
ADAM_spacer1 937..1042 CDD:283607
TSP1 1172..1229 CDD:214559
GON 1495..1687 CDD:285848
col28a1aNP_001334976.1 vWFA_subfamily_ECM 49..214 CDD:238727
Collagen 266..339 CDD:189968
Collagen 311..384 CDD:189968
Collagen 491..548 CDD:189968
Collagen 529..590 CDD:189968
Collagen 561..633 CDD:189968
Collagen 700..776 CDD:189968
VWA 803..980 CDD:306576 28/197 (14%)
Kunitz_BPTI 1117..1168 CDD:278443 14/64 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.