DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdamTS-A and wu:fb59d01

DIOPT Version :9

Sequence 1:NP_996218.1 Gene:AdamTS-A / 41887 FlyBaseID:FBgn0286071 Length:1688 Species:Drosophila melanogaster
Sequence 2:NP_001373281.1 Gene:wu:fb59d01 / 322379 ZFINID:ZDB-GENE-030131-1098 Length:211 Species:Danio rerio


Alignment Length:186 Identity:39/186 - (20%)
Similarity:57/186 - (30%) Gaps:71/186 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   666 GTERLPGEIYSLDAQCQLSFGNDFGYCPTDEECKRLWCNRTSGNSN-----EQCASSNLPWADGT 725
            |||::....|.|.|                :.|...:...|.||.|     ::|..:..|.|   
Zfish    36 GTEKIKKYFYDLQA----------------DSCVPFYFKGTGGNGNRFDSDKECVKACSPKA--- 81

  Fly   726 PCGSSGHWCQRGKCVSNKHGYGRQVNGGWGPWTPFTPCSLTCGGGVQESRRECNQPVPENGGKYC 790
                                  .|:.    |....:.||:....|.      |....|    .|.
Zfish    82 ----------------------LQIY----PTDETSICSMEMDEGT------CFALFP----MYY 110

  Fly   791 TGSRKK------YRSCNTHQCPPGSMDPREQQCYAMNGRNM---NIPGVNPDTKWV 837
            ..:.:|      ||.|..:.....|.:..:|.|.|.:||.|   ::|  |||.|.|
Zfish   111 YNAEEKICRMFIYRGCRGNANRFESREECQQTCLARSGRLMGAADLP--NPDEKTV 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdamTS-ANP_996218.1 Pep_M12B_propep 286..394 CDD:279848
ZnMc_ADAMTS_like 455..655 CDD:239801
Reprolysin 457..655 CDD:279729
Salp15 <696..745 CDD:288931 8/53 (15%)
TSP1 754..806 CDD:214559 11/57 (19%)
ADAM_spacer1 937..1042 CDD:283607
TSP1 1172..1229 CDD:214559
GON 1495..1687 CDD:285848
wu:fb59d01NP_001373281.1 Kunitz_BPTI 27..77 CDD:394972 12/56 (21%)
Kunitz_BPTI 92..143 CDD:394972 12/60 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.