DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdamTS-A and CG31609

DIOPT Version :9

Sequence 1:NP_996218.1 Gene:AdamTS-A / 41887 FlyBaseID:FBgn0286071 Length:1688 Species:Drosophila melanogaster
Sequence 2:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster


Alignment Length:108 Identity:24/108 - (22%)
Similarity:35/108 - (32%) Gaps:31/108 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly  1229 PTYTKSPNALAVSN---WVIGEWGECNE----WCEKTRSVSCSHPYGIGCGSRKPKDVRKCCHIK 1286
            |.....|....:..   |.:...|.|::    |.....:..|...|..|||....:        .
  Fly    15 PVVAVVPQGFTIKQPKCWYVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNR--------F 71

  Fly  1287 YTSDWTDCSVQCGEGVKRKKQSCTRVYKPDVPGTRKRRVYVDE 1329
            ||.:  :|...|            |||:|  |..:||...:||
  Fly    72 YTKE--ECLKTC------------RVYRP--PNRKKREENLDE 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdamTS-ANP_996218.1 Pep_M12B_propep 286..394 CDD:279848
ZnMc_ADAMTS_like 455..655 CDD:239801
Reprolysin 457..655 CDD:279729
Salp15 <696..745 CDD:288931
TSP1 754..806 CDD:214559
ADAM_spacer1 937..1042 CDD:283607
TSP1 1172..1229 CDD:214559 24/108 (22%)
GON 1495..1687 CDD:285848
CG31609NP_723444.2 KU 35..82 CDD:238057 12/68 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.