DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdamTS-A and Adamtsl5

DIOPT Version :9

Sequence 1:NP_996218.1 Gene:AdamTS-A / 41887 FlyBaseID:FBgn0286071 Length:1688 Species:Drosophila melanogaster
Sequence 2:XP_038934914.1 Gene:Adamtsl5 / 314626 RGDID:1305607 Length:714 Species:Rattus norvegicus


Alignment Length:427 Identity:107/427 - (25%)
Similarity:160/427 - (37%) Gaps:120/427 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   752 GGWGPWTPFTPCSLTCGGGVQESRRECNQPVPENGGKYCTGSRKKYRSCN----------THQCP 806
            |.|..|..::.||.:||.||...||.|.: :||.  :.|.|...:||.|.          |..||
  Rat   198 GEWTLWGSWSRCSSSCGRGVSVRRRHCVR-LPEE--ELCWGDSHEYRVCQLPFYPSTFMLTQDCP 259

  Fly   807 PGSMDPREQQCYAMNGRNMNIPGVNPDTKWVPKY-EKDACKLFCRMDMKVTYFMLKSMVTDGTSC 870
            ||::..|:.||...||.  .:.|.....:|||.: ..:.|.|.|..:....|... ..|.|||.|
  Rat   260 PGAIPFRDLQCSLYNGH--PVLGTQKTYQWVPFHGAPNLCDLNCLAEGHAFYHSF-GRVLDGTPC 321

  Fly   871 AVDSFDKCVNGICRPAGCDNELNSIAKLDKCGVCEGRNDTC------------------------ 911
            ...:...||.|.|..||||..|.|....|:||:|.|.||:|                        
  Rat   322 TPGTQGLCVAGRCLSAGCDGLLGSGTLEDRCGLCGGANDSCLFVQRVFRDAGDCPIPPHGLHLRS 386

  Fly   912 -------------------------------HEVTGNLLVSNLLGLNDGNEPNKTLY----YVTR 941
                                           |..|.:.:..||..|:....|....:    .||.
  Rat   387 MVDRGPFNEFGSWEPRLLLIGQCVPVHPTTAHPCTCHRVPENLAALHPKLPPASGAFAGYWNVTL 451

  Fly   942 IPKGASNIIITQRGYPDQNFIVLTDDRDNELLNGKFLKTYPLKFVYAGVTMQYTGSSSVVEQVNT 1006
            ||:||.:|.:|||.:   |.:.|.....:.:|||..:.:.|..:..||..:.||.|:...|.:..
  Rat   452 IPEGARHIRVTQRSH---NHLALVTRDGHYVLNGDGVLSLPGTYEAAGTRVVYTRSAGPEETLQA 513

  Fly  1007 TYSWKLSRDLIVQIISLDVSPSKRQDTVLLSYSYTIDKPPDYEAEVEIYRWEMQ----------- 1060
            |  ...|::|::|::..:.:|.     |...:....::...::|:|....|.::           
  Rat   514 T--GPTSQELLLQVLLREPNPG-----VHFEFWLPRERYGSFQAQVHALGWPLRQPQPREVEPQP 571

  Fly  1061 -----------------APSNC----DSLCEGRSHRL 1076
                             ||..|    ||  .||:|||
  Rat   572 AETTVVPEAIPARVASLAPDPCGPCPDS--RGRAHRL 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdamTS-ANP_996218.1 Pep_M12B_propep 286..394 CDD:279848
ZnMc_ADAMTS_like 455..655 CDD:239801
Reprolysin 457..655 CDD:279729
Salp15 <696..745 CDD:288931
TSP1 754..806 CDD:214559 19/61 (31%)
ADAM_spacer1 937..1042 CDD:283607 28/108 (26%)
TSP1 1172..1229 CDD:214559
GON 1495..1687 CDD:285848
Adamtsl5XP_038934914.1 TSP1 200..246 CDD:214559 18/48 (38%)
ADAM_spacer1 444..541 CDD:368694 28/106 (26%)
NTR_like 608..707 CDD:239600
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3538
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.