| Sequence 1: | NP_996218.1 | Gene: | AdamTS-A / 41887 | FlyBaseID: | FBgn0286071 | Length: | 1688 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005174675.1 | Gene: | LOC101885599 / 101885599 | -ID: | - | Length: | 194 | Species: | Danio rerio |
| Alignment Length: | 201 | Identity: | 87/201 - (43%) |
|---|---|---|---|
| Similarity: | 120/201 - (59%) | Gaps: | 19/201 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 460 LIAVDNSMKQFHGEDLQPYILILMSIVSSIFADASIGNSIRILLVRLISLPNINDQTHSS---NE 521
Fly 522 MLKHFC---QFINQSG----YERDTAMLITREPICGSVPGKICHMLGLAELGTVCSS-SSCSIVQ 578
Fly 579 DTGLPTAFTMAHELGHILNMNHDDDDKCMPYVTRQNNNK-VLHIMSSVMGIHMHPWSWSKCSRHF 642
Fly 643 VSEFLE 648 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| AdamTS-A | NP_996218.1 | Pep_M12B_propep | 286..394 | CDD:279848 | |
| ZnMc_ADAMTS_like | 455..655 | CDD:239801 | 87/201 (43%) | ||
| Reprolysin | 457..655 | CDD:279729 | 87/201 (43%) | ||
| Salp15 | <696..745 | CDD:288931 | |||
| TSP1 | 754..806 | CDD:214559 | |||
| ADAM_spacer1 | 937..1042 | CDD:283607 | |||
| TSP1 | 1172..1229 | CDD:214559 | |||
| GON | 1495..1687 | CDD:285848 | |||
| LOC101885599 | XP_005174675.1 | Reprolysin | 1..194 | CDD:279729 | 85/199 (43%) |
| ZnMc_ADAMTS_like | 1..194 | CDD:239801 | 85/199 (43%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D125522at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.010 | |||||