DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AdamTS-A and adamtsl5

DIOPT Version :9

Sequence 1:NP_996218.1 Gene:AdamTS-A / 41887 FlyBaseID:FBgn0286071 Length:1688 Species:Drosophila melanogaster
Sequence 2:XP_002932288.1 Gene:adamtsl5 / 100379976 XenbaseID:XB-GENE-5867327 Length:525 Species:Xenopus tropicalis


Alignment Length:462 Identity:134/462 - (29%)
Similarity:190/462 - (41%) Gaps:71/462 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   754 WGPWTPFTPCSLTCGGGVQESRRECNQPVPENGGKYCTGSRKKYRSCNTHQCPPGSMDPREQQCY 818
            |..|..::|||.|||||.....|.|  .:.:.|...|.|..::|:.|||..||.|..|.|..||.
 Frog    57 WSVWHSWSPCSRTCGGGAAVRTRTC--LIRDQGSPMCPGEMRQYQVCNTQDCPSGVADFRHFQCS 119

  Fly   819 AMNGRNMNIPGVNPDTKWVPKYE-KDACKLFCRMDMKVTYFMLKSMVTDGTSCAVDSFDKCVNGI 882
            |.|.:    |.:....:|||.|. :..|:|.|..:.:..|:.. ..|.|||||..|....|:||.
 Frog   120 AYNKK----PLMGNYFRWVPFYSGQSDCELSCLAEGQNFYYNF-GRVLDGTSCHSDYDGLCINGQ 179

  Fly   883 CRPAGCDNELNSIAKLDKCGVCEGRNDTC---HEV-TGNLLVSNLLGLNDGNEPNKTLYYVTRIP 943
            |...|||..|.|..|.|.||||.|:|.:|   |.| |.....|.|.|.|:          ||.||
 Frog   180 CLKIGCDLILGSEEKTDICGVCGGKNISCRHYHNVYTTKYPPSGLFGYNE----------VTMIP 234

  Fly   944 KGASNIIITQRGYPDQNFIVLTDDRDNELLNGKFLKTYPLKFVYAGVTMQYTGSSSVVEQVNTTY 1008
            .||:||.:|.|   ..|::.|.:...:.::||.:..:||..:..||..:.|..::...|...:  
 Frog   235 TGATNIKVTDR---SNNYLALRNRNYHYVINGNWAISYPGVYNVAGTKVHYKRAADNQETFES-- 294

  Fly  1009 SWKLSRDLIVQIISLDVSPSKRQDTVLLSYSYTIDKPPDYEAEVEIYRWEMQAPSNCDSLCEGRS 1073
            ....|.||.:.::.       .:..:.:.|.|.:  |.||..:.:..|..:|.        .|..
 Frog   295 QGPTSEDLHIMVLF-------TEQNLGIEYEYWL--PKDYYIQHQRDRSSLQE--------YGEV 342

  Fly  1074 HRLPACISTTQGV-KVAPQFCDKSAMPKIDDRACNTDCRLNLTVTSI--SECSAACGELGTRE-- 1133
            ...|...||||.. |...|........:...|....:...|....||  |:| ..|.::..|:  
 Frog   343 SVPPTHPSTTQPTPKTTAQILTHHIKKQPQARLQRENTEWNQVKESIENSKC-GKCKKVKGRQNK 406

  Fly  1134 -KTYACVQTFTNMQR---SNIVDMSYCKLKFDV----AYHEEC----REGCWVLSEWSTCSKSCG 1186
             |.| |.:.|....|   ...|....|   :|:    .|....    ||..||.   :||  .|.
 Frog   407 VKQY-CQKDFVFRGRVLSKKTVGKETC---YDIQVVMTYKNNFPILRREYIWVP---NTC--DCP 462

  Fly  1187 TGSQQRE 1193
            ..|::||
 Frog   463 YMSEKRE 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AdamTS-ANP_996218.1 Pep_M12B_propep 286..394 CDD:279848
ZnMc_ADAMTS_like 455..655 CDD:239801
Reprolysin 457..655 CDD:279729
Salp15 <696..745 CDD:288931
TSP1 754..806 CDD:214559 19/51 (37%)
ADAM_spacer1 937..1042 CDD:283607 25/104 (24%)
TSP1 1172..1229 CDD:214559 8/22 (36%)
GON 1495..1687 CDD:285848
adamtsl5XP_002932288.1 TSP1 57..107 CDD:214559 19/51 (37%)
ADAM_spacer1 220..322 CDD:368694 29/125 (23%)
NTR_like 408..511 CDD:382999 19/71 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.