DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act88F and Actr3

DIOPT Version :9

Sequence 1:NP_524367.1 Gene:Act88F / 41885 FlyBaseID:FBgn0000047 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_112330.1 Gene:Actr3 / 81732 RGDID:71024 Length:418 Species:Rattus norvegicus


Alignment Length:420 Identity:150/420 - (35%)
Similarity:215/420 - (51%) Gaps:63/420 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ALVIDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEAQSKRG 64
            |.|:|.|:|..|.|:||:..|:.:.||.        ||....:.||.|:...|.::||||..|..
  Rat     7 ACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPT 71

  Fly    65 ILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN 129
            ..| |:||.|||:.:||.||:......:..||..||:|..||||.|||...|||...:||||:||
  Rat    72 YAT-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFN 135

  Fly   130 SPAMYVAIQAVLSLYAS-------GRT-TGIVLDSGDGVSHTVPIYEGFALPHAILRLDLAGRDL 186
            .|.:|:|:||||:|.||       .|| ||.|:||||||:|.:|:.||:.:...|..:.:||||:
  Rat   136 VPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDI 200

  Fly   187 TDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQ---- 247
            |.::.::|.:|..........|..:.:||:..||..|..:|.          ..|: .||.    
  Rat   201 TYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEF----------NKYD-TDGSKWIK 254

  Fly   248 -------------VITIGNERFRCPEALFQPSFLGME-SCGIHETVYNSIMKCDVDIRKDLYANS 298
                         .|.:|.|||..||..|.|.|...: :..|.|.|...|..|.:|:|:.||.|.
  Rat   255 QYTGVNAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNI 319

  Fly   299 VLSGGTTMYPGIADRMQKEIT----------------ALAPSTIKIKIIAPPERKYSVWIGGSIL 347
            |||||:||:.....|:|:::.                .|.|..|.:::|....::|:||.|||:|
  Rat   320 VLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSML 384

  Fly   348 ASLSTFQQMWISKQEYDESGPGIV-HRKCF 376
            ||...|.|:..:|::|:|.||.|. |...|
  Rat   385 ASTPEFYQVCHTKKDYEEIGPSICRHNPVF 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act88FNP_524367.1 PTZ00281 1..376 CDD:173506 149/418 (36%)
Actr3NP_112330.1 PTZ00280 2..417 CDD:240343 150/420 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.