DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act88F and Actl10

DIOPT Version :9

Sequence 1:NP_524367.1 Gene:Act88F / 41885 FlyBaseID:FBgn0000047 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001165111.1 Gene:Actl10 / 70362 MGIID:1917612 Length:346 Species:Mus musculus


Alignment Length:318 Identity:110/318 - (34%)
Similarity:179/318 - (56%) Gaps:29/318 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 YPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMY 134
            :||:||::.:||.:|.:|.......|:|.||:.|||::::|..|...|||:.:::||....||.:
Mouse    37 HPIKHGVVVDWDALEGLWERLMVGGLQVHPEQWPVLVSDSPSAPPKGREKVAELLFEALTVPACH 101

  Fly   135 VAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGFALPHAILRLDLAGRDLTDYLMKILTE--- 196
            :|..|:|:|.:.|..:|:.:::|.||.|..|||.|.:...|..||::||..|:.|...:|..   
Mouse   102 MANTALLALCSIGAFSGLAVEAGAGVCHATPIYAGHSWHKATFRLNVAGSTLSRYFRDLLVAACP 166

  Fly   197 ----RGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPDGQVITIGNERFR 257
                :|.|      |:.|..:|::.|||:|||:.::...|...  ...:.|.:|..:.:|:||||
Mouse   167 DLQLQGLS------RKTVTQLKKRCCYVSLDFQGDICDPARHQ--RACFCLGNGCYVRLGSERFR 223

  Fly   258 CPEALFQPSFLGMESCGIHETVYNSIMKCDVDIRKDLYANSVLSGGTTMYPGIADRMQKEI---- 318
            |||.:||||.||....|:....:.::.|....:|..|....||:||:|::||..:||..|:    
Mouse   224 CPEPIFQPSLLGHPEPGLPTLAFQALQKIPTTLRTRLANTVVLAGGSTLFPGFVERMNLELEAQC 288

  Fly   319 -----TALAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV 371
                 .||.|.     ::|.|.|..:||.|||::|||::||..|:::..|.|.||.:|
Mouse   289 RRHGYPALQPC-----LVAHPGRDTAVWTGGSMMASLNSFQCRWMTRAMYQEHGPLLV 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act88FNP_524367.1 PTZ00281 1..376 CDD:173506 110/318 (35%)
Actl10NP_001165111.1 NBD_sugar-kinase_HSP70_actin 37..341 CDD:302596 109/316 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D649708at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11937
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.