DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Act88F and ACTR3C

DIOPT Version :9

Sequence 1:NP_524367.1 Gene:Act88F / 41885 FlyBaseID:FBgn0000047 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_016868037.1 Gene:ACTR3C / 653857 HGNCID:37282 Length:280 Species:Homo sapiens


Alignment Length:212 Identity:77/212 - (36%)
Similarity:107/212 - (50%) Gaps:38/212 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 MFETFNSPAMYVAIQAVLSLYAS-------GRT-TGIVLDSGDGVSHTVPIYEGFALPHAILRLD 180
            |||:||.|.:|:|:||||:|.||       .|| ||||:||||||:|.:|:.||:.:...|..:.
Human     1 MFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIP 65

  Fly   181 LAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAASTSLEKSYELPD 245
            :||||:|.::.::|.||..........|..:.||||.||:..|..:|.|          .|:: |
Human    66 IAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFA----------KYDV-D 119

  Fly   246 GQ-----------------VITIGNERFRCPEALFQPSFLGMESC-GIHETVYNSIMKCDVDIRK 292
            .|                 ||.:|.|||..||..|.|.|...:|. .|.:.|...|..|.:|:|:
Human   120 PQKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDSMESISDVVDEVIQNCPIDVRR 184

  Fly   293 DLY-ANSVLSGGTTMYP 308
            .|| ...||.|....:|
Human   185 PLYKVLGVLPGRYRDHP 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Act88FNP_524367.1 PTZ00281 1..376 CDD:173506 77/212 (36%)
ACTR3CXP_016868037.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.